Return-Path: <202402281038130ba623d0fc4b4bed821eae6e9220p0eu-c1ffnhycfzuypv@bounces.amazon.fr>
Received: from opme11d3d01nd1.nor.fr.intraorange ([10.79.5.103])
	by opme11d3b64nd1.nor.fr.intraorange with LMTP
	id WBTHIcH93mWFYgAA7YcJgw:T1688:P1:P1
	(envelope-from <202402281038130ba623d0fc4b4bed821eae6e9220p0eu-c1ffnhycfzuypv@bounces.amazon.fr>); Wed, 28 Feb 2024 11:38:13 +0100
Received: from opme11ppr19nd1.nor.fr.intraorange ([10.79.5.103])
	by opme11d3d01nd1.nor.fr.intraorange with LMTP
	id WBTHIcH93mWFYgAA7YcJgw:T1688:P1
	(envelope-from <202402281038130ba623d0fc4b4bed821eae6e9220p0eu-c1ffnhycfzuypv@bounces.amazon.fr>)
	for <MELOFR-200-jIRfDsq6shSq7o+X46PZ+b87jjyz6dFxAN9w3nnewhc=>; Wed, 28 Feb 2024 11:38:13 +0100
Received: from opmta1mti29nd1 ([10.79.5.103])
	by opme11ppr19nd1.nor.fr.intraorange with LMTP
	id WBTHIcH93mWFYgAA7YcJgw:T1688
	(envelope-from <202402281038130ba623d0fc4b4bed821eae6e9220p0eu-c1ffnhycfzuypv@bounces.amazon.fr>)
	for <marc.malroux@orange.fr>; Wed, 28 Feb 2024 11:38:13 +0100
Received: from a1-110.smtp-out.eu-west-1.amazonses.com ([54.240.1.110])
	by smtp.orange.fr with ESMTPS
	id fHJBrjyFv5GdefHKHrdcZP; Wed, 28 Feb 2024 11:38:13 +0100
X-bcc: marc.malroux@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (17)(0000)gggruggvucftvghtrhhoucdtuddrgedvledrgeejgddujecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecuhedttdenucdnofetkffnkffpifculddujedmnecujfgurhepfffhrhfvkffugggtsegrtdersgdttdejnecuhfhrohhmpeetmhgriihonhcurfhrihhmvgcuoehprhhimhgvsegrmhgriihonhdrfhhrqeenucggtffrrghtthgvrhhnpeegffefkeegleduheeigeevlefgleethfejhefhueelhfevueelveelvdekffekgeenucffohhmrghinheprghmrgiiohhnrdhfrhdpphhrihhmvghvihguvghordgtohhmnecukfhppeehgedrvdegtddruddruddutdenucfuphgrmhggtffrrghtthgvrhhnpeegffefkeegleduheeigeevlefgleethfejhefhueelhfevueelveelvdekffekgeenucfuphgrmhetlhhphhgrufhusghjvggtthepmhhishgvrghjohhurhguvgijfhhrohhmpghushgvrhilvhhiuggvohenucfuphgrmhgfrhhlpehhthhtphhsmedssdiffiifrdgrmhgriihonhdrfhhrrehrvghfpgepphgvpgehkedvleduieeludgpledvjeejheelkeeguddphhhtthhpshemsddsfiiffidrrghmrgiiohhnrdhfrhdsmhgtrehrvghfpgepphgvpgehkedvleduieeludgpledvjeejheelkeegudgpphgtrggpphgtpdhhthhtphhsmedssdiffiifrdhprhhimhgvvhhiuggvohdrtghomhdsrg
 gufhhrvggvrehrvghfpgepphgvpgehkedvleduieeludgpledvjeejheelkeegudenucevlhhushhtvghrufhiiigvpeejieenucfrrghrrghmpehhvghloheprgduqdduuddtrdhsmhhtphdqohhuthdrvghuqdifvghsthdquddrrghmrgiiohhnshgvshdrtghomhdpihhnvghtpeehgedrvdegtddruddruddutddpmhgrihhlfhhrohhmpedvtddvgedtvddvkedutdefkedufedtsggriedvfegutdhftgegsgegsggvugekvdduvggrvgeivgelvddvtdhptdgvuhdqtgdufhhfnhhhhigtfhiiuhihphhvsegsohhunhgtvghsrdgrmhgriihonhdrfhhrpdhnsggprhgtphhtthhopedupdhrtghpthhtohepmhgrrhgtrdhmrghlrhhouhigsehorhgrnhhgvgdrfhhr
X-me-spamlevel: not-spam
ARC-Seal: i=1; a=rsa-sha256; d=orange.fr; s=t20230301; t=1709116693; cv=none;
	b=CypbGvrXiB5eiwgJ+sOZW5veWVfaGLmzNrapPDjek8O/A6iQGXv8QupZ83dfdVrCJWBANu+7f3RJKKC+cf/6BRjp9YbqvZzhcute4ltdfRijrAU3AU7d8IWIfUMsA60CDXwY3THMuRe+Zk0aPPCUUSh4S0BvBvEqjDxqfS/zXgobTDNCPWx/dEb+ycnDZNj9d1Nr3iNASpVNpe9sf1N67ThxfeSW9lo2AoFfpcq2JLpWQSuddDrDLZDU/9osnCYhze9hNe3JlNg7wULAQh6WzSgHOKbr/yRSk2xTGRG4F5nhvgixFL5W4ViVJ4TGZkZw4LOeI1N5niAo6IwhN/mPHQ==
ARC-Message-Signature: i=1; a=rsa-sha256; d=orange.fr; s=t20230301;
	t=1709116693; c=relaxed/simple;
	bh=0hHSvWVWUYWwP+SfD71K9tbhS8Jtq22DLmmtk2v5mZM=; h=From:To:Subject;
	b=aV44Zkr9jUinmsOGRAVJ+S+GOi8gBQNyo2dIwcIx/Haa90uRja6/RaEYSTbUyrMLZD2mzStqY1ZXiOGW1OP5l9Hjs6Ul46u86tFTRboiC9bc73LUZrCu+8l7peUQRpmzVBk8Xx1CjgkRFpyUnGW6+PJTy60ZDrEW5ICvrvlhZJ2L00x46ar9r3i1eiV5SqS015Jv1WMBR7bV5gEbcBRaMDz7gMK/OTV9QlryHPj1M0Jt6fVLW5bTV8K/0OfO3pNZKC36MBrojreEx1QRbq/MPCsRDqad8N2YGYsuD5EpyyAzK33KTu8I8hv7BhV2iNZ4/05+401yV6VLfPRPxzqTAQ==
ARC-Authentication-Results: i=1; opmta1mti29nd1; spf=pass (opmta1mti29nd1: domain of 202402281038130ba623d0fc4b4bed821eae6e9220p0eu-c1ffnhycfzuypv@bounces.amazon.fr designates 54.240.1.110 as permited sender) smtp.mailfrom=202402281038130ba623d0fc4b4bed821eae6e9220p0eu-c1ffnhycfzuypv@bounces.amazon.fr;
	arc=none;
	dkim=pass header.d=amazon.fr header.b=est9AJCd;
	dkim=pass header.d=amazonses.com header.b=qgWqBFcX;
	dmarc=pass header.from=amazon.fr
X-ME-Helo: a1-110.smtp-out.eu-west-1.amazonses.com
X-ME-IP: 54.240.1.110
Authentication-Results: opmta1mti29nd1;
	arc=none;
	dkim=pass header.d=amazon.fr header.b=est9AJCd;
	dkim=pass header.d=amazonses.com header.b=qgWqBFcX
X-ME-Entity: ofr
DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple;
	s=gq33a5lsvrexd5iotgsinzfnosbvfxya; d=amazon.fr; t=1709116693;
	h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type;
	bh=0hHSvWVWUYWwP+SfD71K9tbhS8Jtq22DLmmtk2v5mZM=;
	b=est9AJCdo1IXwF2erWyj/kEQTOCJaqvPEEKnNWfdt065aZwueoSmNMbiFovdGBPy
	trJJte8JgXjVpRf/yyKlr8T+MaEUPx5uQegX5VLzPjwKnT1B3YrMdSHgaJ2g5RkDqix
	vEciEj64NI0B2bRH1PSUI/a8tqsuVuaF7cDsceaU=
DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple;
	s=shh3fegwg5fppqsuzphvschd53n6ihuv; d=amazonses.com; t=1709116693;
	h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type:Feedback-ID;
	bh=0hHSvWVWUYWwP+SfD71K9tbhS8Jtq22DLmmtk2v5mZM=;
	b=qgWqBFcX86JCTGLTeD4oUD+UcevD+ovmckJA3pBaJ+vsVovR20UxB4i1KkD72Ese
	CgvUGDNxAh8l9DQ9xR+O2Z+eJRKttARkle1OVcyCgawzz6UnEUgpJv40MHBNsoiQCQp
	w9qtWpgKgwvEmtA1LyUu56vmdGp/fFA57R24wEbE=
Date: Wed, 28 Feb 2024 10:38:13 +0000
From: Amazon Prime <prime@amazon.fr>
Reply-To: Do Not Reply - Amazon <donotreply@amazon.fr>
To: marc.malroux@orange.fr
Message-ID: <0102018def4b1b7e-f39d2b6a-0971-49cd-ba15-435981d5214d-000000@eu-west-1.amazonses.com>
Subject: =?UTF-8?B?TWlzZSDDoCBqb3VyIGRlIFByaW1lIFZpZGVv?=
MIME-Version: 1.0
Content-Type: multipart/alternative; 
	boundary="----=_Part_409474_1618251975.1709116693365"
X-AMAZON-MAIL-RELAY-TYPE: notification
Bounces-to: 202402281038130ba623d0fc4b4bed821eae6e9220p0eu-C1FFNHYCFZUYPV@bounces.amazon.fr
X-AMAZON-METADATA: CA=C1FFNHYCFZUYPV-CU=A326WZ7N20ASCD
X-Original-MessageID: <urn.rtn.msg.202402281038130ba623d0fc4b4bed821eae6e9220p0eu@1709116693367.>
Feedback-ID: 1.eu-west-1.UIAUrMfbpGrxavqnRE0yoZrAUBI9C7GRNUx/kUDo6B4=:AmazonSES
X-SES-Outgoing: 2024.02.28-54.240.1.110

------=_Part_409474_1618251975.1709116693365
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable


Mise =C3=A0 jour de Prime Video
Cher membre Amazon Prime, Nous vous =C3=A9crivons pour vous informer des no=
uveaut=C3=A9s concernant votre exp=C3=A9rience Prime Video. =C3=80 partir d=
u 9 avril 2024, les films et s=C3=A9ries Prime Video incluront de la public=
it=C3=A9 en quantit=C3=A9 limit=C3=A9e*. Cela nous permettra de continuer =
=C3=A0 investir dans des contenus attractifs et d'augmenter nos investissem=
ents sur le long terme, afin de maintenir la qualit=C3=A9 et la quantit=C3=
=A9 des contenus sur Prime Video. Nous visons =C3=A0 avoir sensiblement moi=
ns de publicit=C3=A9s que la t=C3=A9l=C3=A9vision lin=C3=A9aire classique e=
t les autres services de streaming. Il n'y a aucun changement concernant le=
 prix actuel de votre abonnement Prime. Vous pouvez annuler votre abonnemen=
t gratuitement ou consulter votre prochaine date de renouvellement en visit=
ant votre compte [ici](https://www.amazon.fr/mc?ref_=3Dpca_pc). Nous propos=
erons =C3=A9galement une nouvelle option sans publicit=C3=A9 pour =E2=82=AC=
1,99 de plus par mois** =C3=A0 laquelle vous pouvez vous abonner [ici](http=
s://www.primevideo.com/adfree). Les membres Prime b=C3=A9n=C3=A9ficient d'u=
ne large gamme d'avantages offrant le meilleur du shopping et de la livrais=
on, des =C3=A9conomies et du divertissement, comprenant : * La livraison ra=
pide et gratuite sur des millions d'articles =C3=A9ligibles *** * Un acc=C3=
=A8s =C3=A0 du contenu vid=C3=A9o exclusif et vari=C3=A9 en streaming y com=
pris les exclusivit=C3=A9s Prime Video comme *Le Seigneur des Anneaux : Les=
 Anneaux de Pouvoir, The Boys, Tom Clancy's Jack Ryan, Citadel, La Roue du =
Temps, Reacher,* et *L=E2=80=99=C3=89t=C3=A9 o=C3=B9 je suis devenue jolie,=
* ainsi que des blockbusters comme *Air, Creed III, Donjons et Dragons,* de=
s contenus originaux fran=C3=A7ais tels que *LOL : Qui rit, sort !, Sentine=
lle, Medellin, Merci Internet, Escort Boys* et du sport exclusif en direct =
avec Roland Garros. * Des offres et =C3=A9v=C3=A9nements shopping exclusifs=
 comme Prime Day. * 100 millions de chansons et des millions de podcasts sa=
ns publicit=C3=A9 avec Amazon Music Prime. * Deliveroo Plus gratuit pendant=
 un an: livraison gratuite de vos restaurants et plats =C3=A0 emporter pr=
=C3=A9f=C3=A9r=C3=A9s lorsque vous d=C3=A9pensez 25=E2=82=AC ou plus sur De=
liveroo. * Livraison rapide de vos courses alimentaires avec Monoprix : 10%=
 de r=C3=A9duction sur tous vos achats alimentaires, d=E2=80=99hygi=C3=A8ne=
 et d=E2=80=99entretien pendant 6 mois dans la boutique Monoprix sur amazon=
.fr, dans les magasins Monoprix pr=C3=A8s de chez vous, et sur Monoprix.fr.=
 * Le stockage illimit=C3=A9 de photos avec Amazon Photos. * Des avantages =
pour vos jeux vid=C3=A9os pr=C3=A9f=C3=A9r=C3=A9s et jeux gratuits avec Pri=
me Gaming. * Des centaines de livres avec Prime Reading.  Et vous pouvez vo=
us attendre =C3=A0 ce que des fonctionnalit=C3=A9s et programmes suppl=C3=
=A9mentaires soient ajout=C3=A9s =C3=A0 l'avenir pour nos membres Prime. Me=
rci d'=C3=AAtre un membre fid=C3=A8le d'Amazon Prime. Cordialement, L'=C3=
=A9quipe Amazon Prime ** Les clients en Belgique, aux Pays-Bas et au Luxemb=
ourg ne verront pas de publicit=C3=A9s dans leur exp=C3=A9rience pour le mo=
ment.* *** Le contenu d'=C3=A9v=C3=A9nements en direct comme le sport et le=
s cha=C3=AEnes compl=C3=A9mentaires continueront d'inclure de la publicit=
=C3=A9.* **** =C3=A0 l'exception des livres.*
 (www.amazon.fr)
=20

Amazon.fr est le nom commercial d=E2=80=99Amazon EU Sarl, d=E2=80=99Amazon =
Europe Core Sarl, d=E2=80=99Amazon Media EU Sarl et d=E2=80=99Amazon Servic=
es Europe Sarl, ces derni=C3=A8res ayant toutes leur si=C3=A8ge social situ=
=C3=A9 38, avenue John F. Kennedy, L-1855 Luxembourg. =C2=A92024 Amazon.com=
, Inc. ou ses soci=C3=A9t=C3=A9s affili=C3=A9es. Amazon et toutes les marqu=
es associ=C3=A9es sont des marques d'Amazon.com, Inc. ou de ses soci=C3=A9t=
=C3=A9s affili=C3=A9es. Des frais d=E2=80=99exp=C3=A9dition peuvent s=E2=80=
=99appliquer. Le prix et la disponibilit=C3=A9 affich=C3=A9s sur Amazon.fr =
au moment de l=E2=80=99achat seront applicables =C3=A0 votre achat.

Amazon.fr
------=_Part_409474_1618251975.1709116693365
Content-Type: text/html; charset=utf-8
Content-Transfer-Encoding: quoted-printable

<!doctype html><html lang=3D"fr" xmlns=3D"http://www.w3.org/1999/xhtml" xml=
ns:v=3D"urn:schemas-microsoft-com:vml" xmlns:o=3D"urn:schemas-microsoft-com=
:office:office"><head><title></title><!--[if !mso]><!--><meta http-equiv=3D=
"X-UA-Compatible" content=3D"IE=3Dedge"><!--<![endif]--><meta http-equiv=3D=
"Content-Type" content=3D"text/html; charset=3DUTF-8"><meta name=3D"viewpor=
t" content=3D"width=3Ddevice-width,initial-scale=3D1"><style type=3D"text/c=
ss">#outlook a { padding:0; }
      body { margin:0;padding:0;-webkit-text-size-adjust:100%;-ms-text-size=
-adjust:100%; }
      table, td { border-collapse:collapse;mso-table-lspace:0pt;mso-table-r=
space:0pt; }
      img { border:0;height:auto;line-height:100%; outline:none;text-decora=
tion:none;-ms-interpolation-mode:bicubic; }
      p { display:block;margin:13px 0; }</style><!--[if mso]>
    <noscript>
    <xml>
    <o:OfficeDocumentSettings>
      <o:AllowPNG/>
      <o:PixelsPerInch>96</o:PixelsPerInch>
    </o:OfficeDocumentSettings>
    </xml>
    </noscript>
    <![endif]--><!--[if lte mso 11]>
    <style type=3D"text/css">
      .mj-outlook-group-fix { width:100% !important; }
    </style>
    <![endif]--><style type=3D"text/css">@media only screen and (min-width:=
600px) {
        .mj-column-per-100 { width:100% !important; max-width: 100%; }
      }</style><style media=3D"screen and (min-width:600px)">.moz-text-html=
 .mj-column-per-100 { width:100% !important; max-width: 100%; }</style><sty=
le type=3D"text/css">@media (prefers-color-scheme: dark) {
        .rio-card, .rio-card > table {
          background-color: #181A1A !important;
        }
      }
      [data-ogsc] .rio-card, [data-ogsc] .rio-card > table {
          background-color: #181A1A !important;
      }
   =20

        .rio-header strong {
          color: #067D62;
        }
        @media (prefers-color-scheme: dark) {
          .rio-header *{
            color: #FFFFFF !important;
          }
          .rio-header a{
            color: #6ed6e6 !important;
          }
          .rio-header strong {
            color: #13BD96 !important;
          }
        }
        [data-ogsc] .rio-header * {
          color: #FFFFFF !important;
        }
        [data-ogsc] .rio-header a {
          color: #6ed6e6 !important;
        }
       [data-ogsc] .rio-header strong {
          color: #13BD96 !important;
        }
     =20

         .rio-text strong {
          color: #067D62;
        }
        .rio-text img {
          width: 100%;
          height: auto;
        }
        @media (prefers-color-scheme: dark) {
          .rio-text *{
            color: #FFFFFF !important;
          }
          .rio-text a{
            color: #6ed6e6 !important;
          }
          .rio-text strong {
            color: #13BD96 !important;
          }
        }
        [data-ogsc] .rio-text * {
          color: #FFFFFF !important;
        }
        [data-ogsc] .rio-text a {
          color: #6ed6e6 !important;
        }       =20
        [data-ogsc] .rio-text strong {
          color: #13BD96 !important;
        }
     =20

        @media (prefers-color-scheme: dark) {
          .rio-button-secondary *{
            color: #0F1111 !important;
            background: #FEFEFE !important;
            background-color: linear-gradient(#FEFEFE, #FEFEFE )!important;
          }
        }
        [data-ogsc] .rio-button-secondary *{   =20
            color: #0F1111 !important;
            background: #FEFEFE !important;
            background-color: linear-gradient(#FEFEFE, #FEFEFE )!important;
        }</style><style type=3D"text/css">@font-face {
            font-family: "Ember";
            font-weight: 700;
            src: local("Ember"),
            url(https://m.media-amazon.com/images/G/01/outbound/AmazonEmber=
_Bd._CB1515450239_.WOFF) format("woff");
            mso-generic-font-family: swiss;
            mso-font-alt: "Arial";
        }
       =20
        @font-face {
            font-family: "Ember";
            font-weight: 600;
            src: local("Ember"),
            url(https://m.media-amazon.com/images/G/01/outbound/AmazonEmber=
_Bd._CB1515450239_.WOFF) format("woff");
            mso-generic-font-family: swiss;
            mso-font-alt: "Arial";
        }

        @font-face {
            font-family: "Ember";
            font-weight: 500;
            src: local("Ember"),
            url(https://m.media-amazon.com/images/G/01/outbound/AmazonEmber=
_Md._CB1515450239_.WOFF) format("woff");
            mso-generic-font-family: swiss;
            mso-font-alt: "Arial";
        }

        @font-face {
            font-family: "Ember";
            font-weight: 400;
            font-style: normal;
            src: local("Ember"),
            url(https://m.media-amazon.com/images/G/01/outbound/AmazonEmber=
_Rg._CB1515450239_.WOFF) format("woff");
            mso-generic-font-family: swiss;
            mso-font-alt: "Arial";
        }

        @font-face {
            font-family: "Ember";
            font-weight: 200;
            src: local("Ember"),
            url(https://m.media-amazon.com/images/G/01/outbound/AmazonEmber=
_Lt._CB1515450239_.WOFF) format("woff");
            mso-generic-font-family: swiss;
            mso-font-alt: "Arial";
        }
       =20
        @font-face {
            font-family: "Amazon Ember";
            font-weight: 700;
            src: local("Amazon Ember"),
            url(https://m.media-amazon.com/images/G/01/outbound/AmazonEmber=
_Bd._CB1515450239_.WOFF) format("woff");
            mso-generic-font-family: swiss;
            mso-font-alt: "Arial";
        }
       =20
        @font-face {
            font-family: "Amazon Ember";
            font-weight: 600;
            src: local("Amazon Ember"),
            url(https://m.media-amazon.com/images/G/01/outbound/AmazonEmber=
_Bd._CB1515450239_.WOFF) format("woff");
            mso-generic-font-family: swiss;
            mso-font-alt: "Arial";
        }

        @font-face {
            font-family: "Amazon Ember";
            font-weight: 500;
            src: local("Amazon Ember"),
            url(https://m.media-amazon.com/images/G/01/outbound/AmazonEmber=
_Md._CB1515450239_.WOFF) format("woff");
            mso-generic-font-family: swiss;
            mso-font-alt: "Arial";
        }

        @font-face {
            font-family: "Amazon Ember";
            font-style: normal;
            font-weight: 400;
            src: local("Amazon Ember"),
            url(https://m.media-amazon.com/images/G/01/outbound/AmazonEmber=
_Rg._CB1515450239_.WOFF) format("woff");
            mso-generic-font-family: swiss;
            mso-font-alt: "Arial";
        }

        @font-face {
            font-family: "Amazon Ember";
            font-weight: 200;
            src: local("Amazon Ember"),
            url(https://m.media-amazon.com/images/G/01/outbound/AmazonEmber=
_Lt._CB1515450239_.WOFF) format("woff");
            mso-generic-font-family: swiss;
            mso-font-alt: "Arial";
        }
       =20
        * {
          font-family: Ember,'Amazon Ember',Arial,sans-serif;
          border-spacing: 0;
          margin:0;
          padding:0;
        }
        [data-ogsc] :root {
            --body-bg: #181A1A;
            --body-color: #ffffff;
        }
        .rootContent {
          background: #ffffff !important;
        }
       =20
        h1, h2, h3, h4, h5, p, table, th, td, li, .sans, .fonts {
            color: #0f1111;
        }
        a {
            color: #007185;
            text-decoration: none;
        }
       =20
        @media screen and (max-width: 599px) {=20
          .mobile-only {
            display: initial !important;=20
          }
          .desktop-only {
            display: none !important;
            mso-hide: all !important;
          }
        }
       =20
        @media screen and (min-width: 600px) {
            .mobile-only {
                display: none !important;
                mso-hide: all !important;
            }
        }

        @media (prefers-color-scheme: light) {
            :root {
                --body-bg: #ffffff;
                --body-color: #000000;
            }
        }

        @media (prefers-color-scheme: dark ) {
            :root {
                --body-bg: #181A1A;
                --body-color: #ffffff;
            }
            body {
                background-color: #181A1A !important;
            }
           =20
            h1, h2, h3, h4, h5, p, table, th, td, li, .sans, .fonts {
              color: #ffffff;
            }
            a {
              color: #6ED6E6;
            }
            .rootContent, .rootContent > table {
              background: #181A1A !important;
            }
        }
       =20
        [data-ogsc] h1, [data-ogsc] h2, [data-ogsc] h3, [data-ogsc] h4, [da=
ta-ogsc] h5, [data-ogsc] p, [data-ogsc] li, [data-ogsc] .sans, [data-ogsc] =
.fonts {
            color: #ffffff;
        }
       =20
        [data-ogsc] a{
            color: #6ED6E6;
        }
       =20
        [data-ogsc] .rootContent, [data-ogsc] .rootContent > table {
            background: #181A1A !important;
        }

        /* RESET STYLES */
        body {
            background-color: var(--body-bg) !important;
            color: var(--body-color) !important;
            margin: 0 !important;
            padding: 0;
        }
       =20
        body > img {
          position: absolute;
        }

        table {
            border-spacing: 0;
        }

        table th, h3, h4, h5, p {
            font-weight: normal;
            margin: 0;
            padding: 0;
        }

        td {
            padding: 0;
        }

        img {
            border: 0;
        }

        td, a, span {
            word-break: break-word !important;
        }
       =20
        ul, ol {
          margin-left: 32px !important;
        }
       =20
        .button {
          background-color: #FFD814;
          color: #0f1111 !important;
          border-radius: 24px;
          padding: 1px 16px;
          display: inline-block;
          box-shadow: 1px 2px 4px rgba(153, 153, 153, 0.2);
          font-size: 13px;
          line-height: 29px;
          white-space: nowrap;
          text-decoration: none;
          margin-top: 4px;
        }
       =20
        .box-shadow a {
          box-shadow: 1px 2px 4px rgba(153, 153, 153, 0.2);
        }

        body, table, td, a {
            -ms-text-size-adjust: 100%;
            -webkit-text-size-adjust: 100%;
        }
       =20
        /* iOS autolinks */
        .appleBody a, .appleFooter a {
            color: #007185 !important;
            text-decoration: none;
        }

        a[x-apple-data-detectors] {
            color: #007185 !important;
            font-family: inherit !important;
            font-size: inherit !important;
            font-weight: inherit !important;
            line-height: inherit !important;
        }

        /* gmail autolinks */
        u + #body a {
            color: #007185 !important;
            font-family: inherit !important;
            font-size: inherit !important;
            font-weight: inherit !important;
            line-height: inherit !important;
        }


        /* samsung mail autolinks */
        #MessageViewBody a {
            color: #007185 !important;
            font-family: inherit !important;
            font-size: inherit !important;
            font-weight: inherit !important;
            line-height: inherit !important;
        }</style><meta content=3D"text/html; charset=3DUTF-8" http-equiv=3D=
"Content-Type"><meta content=3D"telephone=3Dno" name=3D"format-detection"><=
meta content=3D"width=3Ddevice-width,initial-scale=3D1;user-scalable=3Dno;"=
 name=3D"viewport"><meta content=3D"IE=3D9; IE=3D8; IE=3D7; IE=3DEDGE" http=
-equiv=3D"X-UA-Compatible"><meta name=3D"x-apple-disable-message-reformatti=
ng"><meta content=3D"light dark" name=3D"color-scheme"><meta content=3D"lig=
ht dark" name=3D"supported-color-schemes"><style type=3D"text/css">.product=
ListPrice {
    color: #565959;
    }
      .productDiscount {
    color: #CC0C39;
    }
    .productPrice {
    color: #0F1111;
    }
  @media (prefers-color-scheme: dark) {
       .productListPrice {
        color: #ffffff !important;
    }
       .productDiscount {
        color: #FF8C8C !important;
    }
       .productPrice {
        color: #FFFFFF !important;
    }
  } =20
    [data-ogsc]  .productListPrice {
        color: #ffffff !important;
    }
    [data-ogsc]  .productDiscount {
        color: #FF8C8C !important;
    }
    [data-ogsc] .productPrice {
        color: #FFFFFF !important;
    }</style><style type=3D"text/css">.dealBadge {
       background-color: #CC0C39;
       color: #ffffff;
    }

     .dealText {
        color: #CC0C39;
    }
      =20
@media (prefers-color-scheme: dark) {
 =20
     .dealBadge {
        background-color: #FF8C8C !important;
        color: #000000 !important;
    }

    .dealText {
        color: #FF8C8C !important;
    } =20
}
[data-ogsc]  .dealBadge {
    background-color: #FF8C8C !important;
    color: #000000 !important;
}

[data-ogsc]  .dealText {
    color: #FF8C8C !important;
}</style><style type=3D"text/css">#amazonLogo9yeVzGisR3tiy7eQumR9tW.full {
    max-width: 100% !important;
    padding-left: 0 !important;
    padding-right: 0 !important;
    width: 100% !important;
}

#amazonLogo9yeVzGisR3tiy7eQumR9tW.zeroBorder {
    border: 0;
    border-collapse: collapse;
    border-spacing: 0;
}

#amazonLogo9yeVzGisR3tiy7eQumR9tW .full {
    max-width: 100% !important;
    padding-left: 0 !important;
    padding-right: 0 !important;
    width: 100% !important;
}

#amazonLogo9yeVzGisR3tiy7eQumR9tW .zeroBorder {
    border: 0;
    border-collapse: collapse;
    border-spacing: 0;
}

#amazonLogo9yeVzGisR3tiy7eQumR9tW .light-img {
    background-color: #fff;
    background-image: linear-gradient(#fff, #fff);
}

@media (prefers-color-scheme: light) {
    #amazonLogo9yeVzGisR3tiy7eQumR9tW .light-img {
        display: block !important;
    }

    #amazonLogo9yeVzGisR3tiy7eQumR9tW .dark-img {
        display: none !important;
    }
}

@media (prefers-color-scheme: dark) {
    #amazonLogo9yeVzGisR3tiy7eQumR9tW .content {
        background-color: #181A1A !important;
    }

    #amazonLogo9yeVzGisR3tiy7eQumR9tW .light-img {
        display: none !important;
    }

    #amazonLogo9yeVzGisR3tiy7eQumR9tW .dark-img {
        display: block !important;
    }
}

[data-ogsc] #amazonLogo9yeVzGisR3tiy7eQumR9tW .content {
    background-color: #181A1A !important;
}

[data-ogsc] #amazonLogo9yeVzGisR3tiy7eQumR9tW .light-img {
    display: none !important;
}

[data-ogsc] #amazonLogo9yeVzGisR3tiy7eQumR9tW .dark-img {
    display: block !important;
}</style><style type=3D"text/css">#transactionalFooter8FyCdw78FGmu11F3fwaKb=
t.full {
    max-width: 100% !important;
    padding-left: 0 !important;
    padding-right: 0 !important;
    width: 100% !important;
}

#transactionalFooter8FyCdw78FGmu11F3fwaKbt.zeroBorder {
    border: 0;
    border-collapse: collapse;
    border-spacing: 0;
}

#transactionalFooter8FyCdw78FGmu11F3fwaKbt .sans {
    font-family: Ember, Helvetica, Arial, sans-serif;
    color: #494D4D;
}

#transactionalFooter8FyCdw78FGmu11F3fwaKbt p, #transactionalFooter8FyCdw78F=
Gmu11F3fwaKbt .additionalText * {
    color: #494D4D;
    font-size: 14px;
    font-weight: 400;
    line-height: 20px;
    margin: 0;
    text-decoration: none;
}

#transactionalFooter8FyCdw78FGmu11F3fwaKbt .footerlinks a, #transactionalFo=
oter8FyCdw78FGmu11F3fwaKbt a {
    color: #007185 !important;
    text-decoration: none;
}

#transactionalFooter8FyCdw78FGmu11F3fwaKbt .full {
    max-width: 100% !important;
    padding-left: 0 !important;
    padding-right: 0 !important;
    width: 100% !important;
}

#transactionalFooter8FyCdw78FGmu11F3fwaKbt .zeroBorder {
    border: 0;
    border-collapse: collapse;
    border-spacing: 0;
}

#transactionalFooter8FyCdw78FGmu11F3fwaKbt .light-img {
    background-color: #fff;
    background-image: linear-gradient(#fff, #fff);
}

@media (prefers-color-scheme: light) {
    #transactionalFooter8FyCdw78FGmu11F3fwaKbt .light-img {
        display: block !important;
    }

    #transactionalFooter8FyCdw78FGmu11F3fwaKbt .dark-img {
        display: none !important;
    }

    #transactionalFooter8FyCdw78FGmu11F3fwaKbt .content {
        background-color: #f0f2f2 !important;
    }
}

@media (prefers-color-scheme: dark) {
    #transactionalFooter8FyCdw78FGmu11F3fwaKbt .light-img {
        display: none !important;
    }

    #transactionalFooter8FyCdw78FGmu11F3fwaKbt .dark-img {
        display: block !important;
    }

    #transactionalFooter8FyCdw78FGmu11F3fwaKbt .sans {
        color: #C8CCCC !important;
    }

    #transactionalFooter8FyCdw78FGmu11F3fwaKbt .additionalText * {
        color: #C8CCCC !important;
    }

    #transactionalFooter8FyCdw78FGmu11F3fwaKbt a, #transactionalFooter8FyCd=
w78FGmu11F3fwaKbt .footerlinks a {
        color: #6ed6e6 !important;
    }

    #transactionalFooter8FyCdw78FGmu11F3fwaKbt .content {
        background-color: #303333 !important;
    }
}

[data-ogsc] #transactionalFooter8FyCdw78FGmu11F3fwaKbt .content {
    background-color: #303333 !important;
}

[data-ogsc] #transactionalFooter8FyCdw78FGmu11F3fwaKbt .light-img {
    display: none !important;
}

[data-ogsc] #transactionalFooter8FyCdw78FGmu11F3fwaKbt .dark-img {
    display: block !important;
}

[data-ogsc] #transactionalFooter8FyCdw78FGmu11F3fwaKbt .sans {
    color: #C8CCCC !important;
}

[data-ogsc] #transactionalFooter8FyCdw78FGmu11F3fwaKbt .additionalText * {
    color: #C8CCCC !important;
}

[data-ogsc] #transactionalFooter8FyCdw78FGmu11F3fwaKbt a, [data-ogsc] #tran=
sactionalFooter8FyCdw78FGmu11F3fwaKbt .footerlinks a {
    color: #6ed6e6 !important;
}</style><!--[if gte mso 9]>
    <xml>
        <o:OfficeDocumentSettings>
            <o:AllowPNG />
            <o:PixelsPerInch>96</o:PixelsPerInch>
        </o:OfficeDocumentSettings>
    </xml>
    <style>
        body, h1, h2, h3, h4, table, th, td, p, li, a, .sans, .fonts {
            font-family: Helvetica, Arial, sans-serif !important;
        }
        [data-ogsc] .rootContent, [data-ogsc] .rootContent > table{
          background: #181A1A !important;
        }
    </style>
    <![endif]--></head><body class=3D"body" style=3D"word-spacing:normal;">=
<img width=3D"1" height=3D"1" src=3D"https://www.amazon.fr/gp/r.html?C=3D1Y=
THHJY0YJ0D0&K=3D2X4HHPD5I59II&M=3Durn:rtn:msg:202402281038130ba623d0fc4b4be=
d821eae6e9220p0eu&R=3D3PNX513D63UBY&T=3DO&U=3Dhttps%3A%2F%2Fimages-eu.ssl-i=
mages-amazon.com%2Fimages%2FG%2F01%2Fnav%2Ftransp.gif&H=3DIPOHUFZJZW7MXR6MB=
JJT248ZOMWA&ref_=3Dpe_58291691_927759841_opens" /><div style=3D"display:non=
e;font-size:1px;color:#ffffff;line-height:1px;max-height:0px;max-width:0px;=
opacity:0;overflow:hidden;">Mise =C3=A0 jour de Prime Video&#847; &zwnj; &n=
bsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#=
8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &=
shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#8=
47; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zw=
nj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nb=
sp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8=
199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &s=
hy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#84=
7; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwn=
j; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbs=
p; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#81=
99; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &sh=
y;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847=
; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj=
; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp=
; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#819=
9; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy=
;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847;=
 &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj;=
 &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp;=
 &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199=
; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;=
&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; =
&zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; =
&nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; =
&#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199;=
 &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&=
#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &=
zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &=
nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &=
#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; =
&shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#=
847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &z=
wnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &n=
bsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#=
8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &=
shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#8=
47; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zw=
nj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nb=
sp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8=
199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &s=
hy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#84=
7; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwn=
j; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbs=
p; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#81=
99; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &sh=
y;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847=
; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj=
; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp=
; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#819=
9; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy=
;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847;=
 &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj;=
 &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp;=
 &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199=
; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;=
&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; =
&zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; =
&nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; =
&#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199;=
 &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&=
#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &=
zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &=
nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &=
#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; =
&shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#=
847; &zwnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;&#847; &z=
wnj; &nbsp; &#8199; &shy;&#847; &zwnj; &nbsp; &#8199; &shy;</div><div class=
=3D"body" lang=3D"fr"><!--[if mso | IE]><table align=3D"center" border=3D"0=
" cellpadding=3D"0" cellspacing=3D"0" class=3D"rootContent-outlook" role=3D=
"presentation" style=3D"width:600px;" width=3D"600" bgcolor=3D"#ffffff" ><t=
r><td style=3D"line-height:0px;font-size:0px;mso-line-height-rule:exactly;"=
><![endif]--><div class=3D"rootContent" style=3D"background:#ffffff;backgro=
und-color:#ffffff;margin:0px auto;max-width:600px;"><table align=3D"center"=
 border=3D"0" cellpadding=3D"0" cellspacing=3D"0" role=3D"presentation" sty=
le=3D"background:#ffffff;background-color:#ffffff;width:100%;"><tbody><tr><=
td style=3D"direction:ltr;font-size:0px;padding:0px 0px 4px 0px;text-align:=
left;"><!--[if mso | IE]><table role=3D"presentation" border=3D"0" cellpadd=
ing=3D"0" cellspacing=3D"0"><![endif]--> <!-- LOGO --><!-- PRIME LOGO -->  =
 <!-- ALEXA LOGO --><!-- AMAZON BUSINESS LOGO -->    <table id=3D"amazonLog=
o9yeVzGisR3tiy7eQumR9tW" class=3D"full zeroBorder" style=3D"width: 100%;" r=
ole=3D"presentation"><tbody><tr><td class=3D"content" style=3D"padding:0; t=
ext-align:left; background-color: #FFFFFF"><!--[if gte mso 9]><table width=
=3D"600"><tr><td><![endif]--> <a href=3D"https://www.amazon.fr/gp/r.html?C=
=3D1YTHHJY0YJ0D0&K=3D2X4HHPD5I59II&M=3Durn:rtn:msg:202402281038130ba623d0fc=
4b4bed821eae6e9220p0eu&R=3D1NXWWE2TZ19YR&T=3DC&U=3Dhttps%3A%2F%2Fwww.amazon=
.fr%3Fref_%3Dpe_58291691_927759841&H=3DRDY0DDYDY9OQJKDKXCJPHZAAOBYA&ref_=3D=
pe_58291691_927759841" target=3D"_blank"><img class=3D"light-img" height=3D=
"72" role=3D"presentation" src=3D"https://m.media-amazon.com/images/G/01/ou=
tbound/OutboundTemplates/Prime_Established_Logo_Light._BG255,255,255_.png" =
style=3D" display:block;background-color: #ffffff;width:auto; height:72px; =
max-height:72px; max-width:100%; border:0; float:left;" alt=3D""> <!--[if !=
mso]><! --><img class=3D"dark-img" height=3D"72" role=3D"presentation" src=
=3D"https://m.media-amazon.com/images/G/01/outbound/OutboundTemplates/Prime=
_Established_Logo_Dark.png" style=3D"display:none; width:auto; height:72px;=
 max-height:72px; max-width:100%; border:0; float:left;" alt=3D""><!--<![en=
dif]--> </a><!--[if gte mso 9]></td></tr></table><![endif]--></td></tr></tb=
ody></table><!--[if mso | IE]></table><![endif]--></td></tr></tbody></table=
></div><!--[if mso | IE]></td></tr></table><![endif]--><!--[if mso | IE]><t=
able align=3D"center" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" clas=
s=3D"rootContent-outlook" role=3D"presentation" style=3D"width:600px;" widt=
h=3D"600" bgcolor=3D"#ffffff" ><tr><td style=3D"line-height:0px;font-size:0=
px;mso-line-height-rule:exactly;"><![endif]--><div class=3D"rootContent" st=
yle=3D"background:#ffffff;background-color:#ffffff;margin:0px auto;max-widt=
h:600px;"><table align=3D"center" border=3D"0" cellpadding=3D"0" cellspacin=
g=3D"0" role=3D"presentation" style=3D"background:#ffffff;background-color:=
#ffffff;width:100%;"><tbody><tr><td style=3D"direction:ltr;font-size:0px;pa=
dding:4px 8px 4px 8px;text-align:left;"><!--[if mso | IE]><table role=3D"pr=
esentation" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"><![endif]--> <=
!--[if mso | IE]><tr><td class=3D"sonar-transactional-copy-outlook sonar-tr=
ansactional-copy-v1-outlook" width=3D"600px" ><table align=3D"center" borde=
r=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"rio-card-outlook" role=
=3D"presentation" style=3D"width:584px;" width=3D"584" bgcolor=3D"#ffffff" =
><tr><td style=3D"line-height:0px;font-size:0px;mso-line-height-rule:exactl=
y;"><![endif]--><div class=3D"rio-card" style=3D"background:#ffffff;backgro=
und-color:#ffffff;margin:0px auto;border-radius:4px;max-width:584px;"><tabl=
e align=3D"center" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" role=3D=
"presentation" style=3D"background:#ffffff;background-color:#ffffff;width:1=
00%;border-radius:4px;"><tbody><tr><td style=3D"direction:ltr;font-size:0px=
;padding:12px 8px 16px 8px;text-align:center;"><!--[if mso | IE]><table rol=
e=3D"presentation" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"><tr><td=
 class=3D"" width=3D"584px" ><![endif]--><div class=3D"mj-column-per-100 mj=
-outlook-group-fix" style=3D"font-size:0;line-height:0;text-align:left;disp=
lay:inline-block;width:100%;direction:ltr;"><!--[if mso | IE]><table border=
=3D"0" cellpadding=3D"0" cellspacing=3D"0" role=3D"presentation" ><tr><td s=
tyle=3D"vertical-align:top;width:568px;" ><![endif]--><div class=3D"mj-colu=
mn-per-100 mj-outlook-group-fix" style=3D"font-size:0px;text-align:left;dir=
ection:ltr;display:inline-block;vertical-align:top;width:100%;"><table bord=
er=3D"0" cellpadding=3D"0" cellspacing=3D"0" role=3D"presentation" width=3D=
"100%"><tbody><tr><td style=3D"vertical-align:top;padding:0;"><table border=
=3D"0" cellpadding=3D"0" cellspacing=3D"0" role=3D"presentation" width=3D"1=
00%"><tbody><tr><td class=3D"rio-header" style=3D"font-size:0px;padding:0;w=
ord-break:break-word;"><div style=3D"font-family:Ember,'Amazon Ember',Arial=
,sans-serif;font-size:15px;line-height:1;text-align:left;color:#000000;"><h=
2 style=3D"margin:0;padding:0;font-family:Ember,'Amazon Ember',Arial,sans-s=
erif;font-weight:700;font-size:18px;line-height:22px;color:#0F1111;">Mise &=
agrave; jour de Prime Video</h2></div></td></tr><tr><td class=3D"rio-spacer=
" style=3D"font-size:0px;padding:0;word-break:break-word;"><div style=3D"he=
ight:8px;line-height:8px;">&#8202;</div></td></tr><tr><td class=3D"rio-text=
" style=3D"font-size:0px;padding:0;word-break:break-word;"><div style=3D"fo=
nt-family:Ember,'Amazon Ember',Arial,sans-serif;font-size:15px;font-weight:=
400;line-height:20px;text-align:left;color:#0F1111;"><br />=20
<p>Cher membre Amazon Prime,</p>
<br />=20
<p>Nous vous &eacute;crivons pour vous informer des nouveaut&eacute;s conce=
rnant votre exp&eacute;rience Prime Video. &Agrave; partir du 9 avril 2024,=
 les films et s&eacute;ries Prime Video incluront de la publicit&eacute; en=
 quantit&eacute; limit&eacute;e*. Cela nous permettra de continuer &agrave;=
 investir dans des contenus attractifs et d'augmenter nos investissements s=
ur le long terme, afin de maintenir la qualit&eacute; et la quantit&eacute;=
 des contenus sur Prime Video. Nous visons &agrave; avoir sensiblement moin=
s de publicit&eacute;s que la t&eacute;l&eacute;vision lin&eacute;aire clas=
sique et les autres services de streaming. Il n'y a aucun changement concer=
nant le prix actuel de votre abonnement Prime. Vous pouvez annuler votre ab=
onnement gratuitement ou consulter votre prochaine date de renouvellement e=
n visitant votre compte <a href=3D"https://www.amazon.fr/gp/r.html?C=3D1YTH=
HJY0YJ0D0&K=3D2X4HHPD5I59II&M=3Durn:rtn:msg:202402281038130ba623d0fc4b4bed8=
21eae6e9220p0eu&R=3D34YDXN1R01PRB&T=3DC&U=3Dhttps%3A%2F%2Fwww.amazon.fr%2Fm=
c%3Fref_%3Dpe_58291691_927759841_pca_pc&H=3DSO9OMLHAKFPJRM7A3FAAP8YINVAA&re=
f_=3Dpe_58291691_927759841_pca_pc" rel=3D"nofollow">ici</a>. Nous proposero=
ns &eacute;galement une nouvelle option sans publicit&eacute; pour =E2=82=
=AC1,99 de plus par mois** &agrave; laquelle vous pouvez vous abonner <a hr=
ef=3D"https://www.amazon.fr/gp/f.html?C=3D1YTHHJY0YJ0D0&K=3D2X4HHPD5I59II&M=
=3Durn:rtn:msg:202402281038130ba623d0fc4b4bed821eae6e9220p0eu&R=3DOSY6AJPZE=
5O5&T=3DC&U=3Dhttps%3A%2F%2Fwww.primevideo.com%2Fadfree%3Fref_%3Dpe_5829169=
1_927759841&H=3DGHZMFFHRVNNMBHSY0XIAWUBXOO0A&ref_=3Dpe_58291691_927759841" =
rel=3D"nofollow">ici</a>.</p>
<br />=20
<p>Les membres Prime b&eacute;n&eacute;ficient d'une large gamme d'avantage=
s offrant le meilleur du shopping et de la livraison, des &eacute;conomies =
et du divertissement, comprenant :</p>
<br />=20
<ul>=20
 <li>La livraison rapide et gratuite sur des millions d'articles &eacute;li=
gibles ***</li>=20
 <li>Un acc&egrave;s &agrave; du contenu vid&eacute;o exclusif et vari&eacu=
te; en streaming y compris les exclusivit&eacute;s Prime Video comme <i>Le =
Seigneur des Anneaux : Les Anneaux de Pouvoir, The Boys, Tom Clancy's Jack =
Ryan, Citadel, La Roue du Temps, Reacher,</i> et <i>L=E2=80=99&Eacute;t&eac=
ute; o&ugrave; je suis devenue jolie,</i> ainsi que des blockbusters comme =
<i>Air, Creed III, Donjons et Dragons,</i> des contenus originaux fran&cced=
il;ais tels que <i>LOL : Qui rit, sort !, Sentinelle, Medellin, Merci Inter=
net, Escort Boys</i> et du sport exclusif en direct avec Roland Garros.</li=
>=20
 <li>Des offres et &eacute;v&eacute;nements shopping exclusifs comme Prime =
Day.</li>=20
 <li>100 millions de chansons et des millions de podcasts sans publicit&eac=
ute; avec Amazon Music Prime.</li>=20
 <li>Deliveroo Plus gratuit pendant un an: livraison gratuite de vos restau=
rants et plats &agrave; emporter pr&eacute;f&eacute;r&eacute;s lorsque vous=
 d&eacute;pensez 25=E2=82=AC ou plus sur Deliveroo.</li>=20
 <li>Livraison rapide de vos courses alimentaires avec Monoprix : 10% de r&=
eacute;duction sur tous vos achats alimentaires, d=E2=80=99hygi&egrave;ne e=
t d=E2=80=99entretien pendant 6 mois dans la boutique Monoprix sur amazon.f=
r, dans les magasins Monoprix pr&egrave;s de chez vous, et sur Monoprix.fr.=
</li>=20
 <li>Le stockage illimit&eacute; de photos avec Amazon Photos.</li>=20
 <li>Des avantages pour vos jeux vid&eacute;os pr&eacute;f&eacute;r&eacute;=
s et jeux gratuits avec Prime Gaming.</li>=20
 <li>Des centaines de livres avec Prime Reading.</li>=20
</ul>=20
<br />
<p>Et vous pouvez vous attendre &agrave; ce que des fonctionnalit&eacute;s =
et programmes suppl&eacute;mentaires soient ajout&eacute;s &agrave; l'aveni=
r pour nos membres Prime.</p>
<br />=20
<p>Merci d'&ecirc;tre un membre fid&egrave;le d'Amazon Prime.</p>
<br />=20
<p>Cordialement,</p>=20
<p>L'&eacute;quipe Amazon Prime</p>
<br />=20
<p><i>* Les clients en Belgique, aux Pays-Bas et au Luxembourg ne verront p=
as de publicit&eacute;s dans leur exp&eacute;rience pour le moment.</i></p>=
=20
<p><i>** Le contenu d'&eacute;v&eacute;nements en direct comme le sport et =
les cha&icirc;nes compl&eacute;mentaires continueront d'inclure de la publi=
cit&eacute;.</i></p>=20
<p><i>*** &agrave; l'exception des livres.</i></p></div></td></tr></tbody><=
/table></td></tr></tbody></table></div><!--[if mso | IE]></td></tr></table>=
<![endif]--></div><!--[if mso | IE]></td></tr></table><![endif]--></td></tr=
></tbody></table></div><!--[if mso | IE]></td></tr></table></td></tr><![end=
if]--> <!--[if mso | IE]></table><![endif]--></td></tr></tbody></table></di=
v><!--[if mso | IE]></td></tr></table><![endif]--><!--[if mso | IE]><table =
align=3D"center" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"=
rootContent-outlook" role=3D"presentation" style=3D"width:600px;" width=3D"=
600" bgcolor=3D"#ffffff" ><tr><td style=3D"line-height:0px;font-size:0px;ms=
o-line-height-rule:exactly;"><![endif]--><div class=3D"rootContent" style=
=3D"background:#ffffff;background-color:#ffffff;margin:0px auto;max-width:6=
00px;"><table align=3D"center" border=3D"0" cellpadding=3D"0" cellspacing=
=3D"0" role=3D"presentation" style=3D"background:#ffffff;background-color:#=
ffffff;width:100%;"><tbody><tr><td style=3D"direction:ltr;font-size:0px;pad=
ding:4px 0px 0px 0px;text-align:left;"><!--[if mso | IE]><table role=3D"pre=
sentation" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"><![endif]--> <t=
able id=3D"transactionalFooter8FyCdw78FGmu11F3fwaKbt" class=3D"zeroBorder f=
ooter" style=3D"margin-left: auto; margin-right: auto; width: 100%; font-si=
ze: 14px;" role=3D"presentation"><tbody><tr><td class=3D"content" style=3D"=
background-color: #F0F2F2"><table role=3D"presentation"><tbody><tr><td styl=
e=3D"padding: 32px 16px 0; word-break:break-word !important;"><p class=3D"s=
ans footerlinks" style=3D"word-break:break-word !important;">Amazon.fr est =
le nom commercial d=E2=80=99Amazon EU Sarl, d=E2=80=99Amazon Europe Core Sa=
rl, d=E2=80=99Amazon Media EU Sarl et d=E2=80=99Amazon Services Europe Sarl=
, ces derni=C3=A8res ayant toutes leur si=C3=A8ge social situ=C3=A9 38, ave=
nue John F. Kennedy, L-1855 Luxembourg. =C2=A92024 Amazon.com, Inc. ou ses =
soci=C3=A9t=C3=A9s affili=C3=A9es. Amazon et toutes les marques associ=C3=
=A9es sont des marques d'Amazon.com, Inc. ou de ses soci=C3=A9t=C3=A9s affi=
li=C3=A9es.
Des frais d=E2=80=99exp=C3=A9dition peuvent s=E2=80=99appliquer. Le prix et=
 la disponibilit=C3=A9 affich=C3=A9s sur Amazon.fr au moment de l=E2=80=99a=
chat seront applicables =C3=A0 votre achat.</p></td></tr><tr><td style=3D"p=
adding: 36px 16px 0 0;"><img class=3D"light-img" height=3D"43" role=3D"pres=
entation" src=3D"https://m.media-amazon.com/images/G/01/outbound/OutboundTe=
mplates/Smile_Logo_Light._BG240,242,242_.png" style=3D"width:auto; height:4=
3px; max-height: 43px; max-width:100%; display:block; border:0; float:left;=
 background-color: #F0F2F2; background-image: linear-gradient(#F0F2F2, #F0F=
2F2)" alt=3D"Amazon.fr"> <!--[if !mso]><! --><img class=3D"dark-img" style=
=3D"display:none; width:auto; height:43px; max-height: 43px; max-width:100%=
; border:0; float:left;" height=3D"43" role=3D"presentation" src=3D"https:/=
/m.media-amazon.com/images/G/01/outbound/OutboundTemplates/Smile_Logo_Dark.=
png" alt=3D"Amazon.fr"><!--<![endif]--></td></tr></tbody></table></td></tr>=
</tbody></table> <!--[if mso | IE]></table><![endif]--></td></tr></tbody></=
table></div><!--[if mso | IE]></td></tr></table><![endif]--></div><img widt=
h=3D"1" height=3D"1" src=3D"https://www.amazon.fr/gp/r.html?C=3D1YTHHJY0YJ0=
D0&K=3D2X4HHPD5I59II&M=3Durn:rtn:msg:202402281038130ba623d0fc4b4bed821eae6e=
9220p0eu&R=3DNQEQOJQ762MZ&T=3DE&U=3Dhttps%3A%2F%2Fimages-eu.ssl-images-amaz=
on.com%2Fimages%2FG%2F01%2Fnav%2Ftransp.gif&H=3DAN6XMOI6LRGMLQSYEIRAVZCVWD8=
A&ref_=3Dpe_58291691_927759841_open" /></body></html>
------=_Part_409474_1618251975.1709116693365--
Ôs†bw      iéá´iéá´IjÐfÿÿÿÿ   a    ~49f85b7a,:imap://marc.malroux%40orange.fr@imap.orange.fr:993/fetch%3EUID%3E/INBOX/TRASH%3E239285 security-info FnhllAKWRHGAlo+ESXykKAAAAAAAAAAAwAAAAAAAAEaphjojH6pBabDSgSnsfLHeAAAAAgAAAAAAAAAAAAAAAAAAAAEAOQFmCjImkVxP+7sgiYWmMt8FvcOXmlQiTNWFiWlrbpbqgwAAAAAAAAczMIIHLzCCBhegAwIBAgIQBclsKZMO8zxOPkkVwanUCzANBgkqhkiG9w0BAQsFADBZMQswCQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMTMwMQYDVQQDEypEaWdpQ2VydCBHbG9iYWwgRzIgVExTIFJTQSBTSEEyNTYgMjAyMCBDQTEwHhcNMjUwOTEzMDAwMDAwWhcNMjYwOTE1MjM1OTU5WjBYMQswCQYDVQQGEwJGUjEcMBoGA1UEBxMTSVNTWSBMRVMgTU9VTElORUFVWDESMBAGA1UEChMJT3JhbmdlIFNBMRcwFQYDVQQDEw5pbWFwLm9yYW5nZS5mcjCCASIwDQYJKoZIhvcNAQEBBQADggEPADCCAQoCggEBANNuk+RG9+cacpZd+/r1NuDEMsruxHcqH8DIfeEHXTJiisMyJXgeHPgKI4rc3+mv1bhDUAa5ai09LYFgfimd+1Ua2q7E/0jD0u9vm6eo3Jtyna2zPr8xNs7MxFBKBjpaJEUsdfBrtV3CCRnotL1MYO5kUMD+z6UubQ+adXkqRGSFg7EeOmgxtFGgiwV4im78EnxHN2XVSaw8pFRvtquC2hUIZEgrt7vdYYmKsrwHv0fhDFbD1ss9/fD4qQUNmm8bzMWOnV31utNgPlN1WeFWU2fXxUSKP9HPwQZoNXVhiH/LOi3YHHtte5L0fQuo6jvrtqfI2tbSndrjEZboYhKh4IcCAwEAAaOCA/IwggPuMB8GA1UdIwQYMBaAFHSFgMBmx9833s+9KTeqAx2+7c0XMB0GA1UdDgQWBBQrJSpubphCzigM0LK45MCCwb9UOzCBgwYDVR0RBHwweoIOaW1hcC5vcmFuZ2UuZnKCD2ltYXA0Lm9yYW5nZS5mcoIPaW1hcC53YW5hZG9vLmZygg1wb3Aub3JhbmdlLmZygg5wb3Aud2FuYWRvby5mcoIOcG9wMy5vcmFuZ2UuZnKCF3BvcC5tYWlsc2FudGUub3JhbmdlLmZyMD4GA1UdIAQ3MDUwMwYGZ4EMAQICMCkwJwYIKwYBBQUHAgEWG2h0dHA6Ly93d3cuZGlnaWNlcnQuY29tL0NQUzAOBgNVHQ8BAf8EBAMCBaAwHQYDVR0lBBYwFAYIKwYBBQUHAwEGCCsGAQUFBwMCMIGfBgNVHR8EgZcwgZQwSKBGoESGQmh0dHA6Ly9jcmwzLmRpZ2ljZXJ0LmNvbS9EaWdpQ2VydEdsb2JhbEcyVExTUlNBU0hBMjU2MjAyMENBMS0xLmNybDBIoEagRIZCaHR0cDovL2NybDQuZGlnaWNlcnQuY29tL0RpZ2lDZXJ0R2xvYmFsRzJUTFNSU0FTSEEyNTYyMDIwQ0ExLTEuY3JsMIGHBggrBgEFBQcBAQR7MHkwJAYIKwYBBQUHMAGGGGh0dHA6Ly9vY3NwLmRpZ2ljZXJ0LmNvbTBRBggrBgEFBQcwAoZFaHR0cDovL2NhY2VydHMuZGlnaWNlcnQuY29tL0RpZ2lDZXJ0R2xvYmFsRzJUTFNSU0FTSEEyNTYyMDIwQ0ExLTEuY3J0MAwGA1UdEwEB/wQCMAAwggF7BgorBgEEAdZ5AgQCBIIBawSCAWcBZQB1ANgJVTuUT3r/yBYZb5RPhauw+Pxeh1UmDxXRLnK7RUsUAAABmUNwVGYAAAQDAEYwRAIgLyIiiEn+3O0wurWsrU9OnZ0LZiN8AwXd94b8VjEhMeYCIFmPYd5L8xzFwapyvpeBzOG0VZeiabDLGkb4S+SAM2n9AHUAwjF+V0UZo0XufzjespBB68fCIVoiv3/Vta12mtkOUs0AAAGZQ3BUaAAABAMARjBEAiBm2ZlIATBlLlx/6QvZJ3cIHUJQMpUyQs7VcTOwu87rvwIgVdU4d97bZf/YFZAAp4iV4vomjWnEbYCD3KQNHnRHr6EAdQCUTkOH+uzB74HzGSQmqBhlAcfTXzgCAT9yZ31VNy4Z2AAAAZlDcFSAAAAEAwBGMEQCIB6LrXlAfOAPWkZFTkepLl4EEyvKm4pmpEQDVDCpblx+AiB02/ymEJIdmf44WnLwUHCT+CaP95eo3SUAXaOR77vtODANBgkqhkiG9w0BAQsFAAOCAQEAuC7Hw6ujCk1dlLvBtWGwGb9u7Ig4zPtHp6swoqe9UCL1/IkJhg/zjWodELc2/qVPZ6FD/ck+y/0JrTJYp0OOj4W5P/PyLsD1lhEO9dninVjgmrBgyzrSIKChQQfADOtOJPJOt2ltSKD3sRygzpEkX+EcMXNPIG4LY+KVtQX45/98SUZCJs/gP+QZ04/xeFqIwvjITdnXI4l+hTE1VAoyMcaUYPbTdSiKERrEBjR1z1HTVBDrtKNBzButfU12mBIP0/dQJux6MhQPu1QP9jcjKG72ITUpB4uZIUb2UWQj3hjH3XLfHT2YP8LQA7lpmkAOdZUdVZCWx8AY8p2BwydAGBMBAAQAAAAAAAEBAAAFAAAABFAyNTYAAAAOUlNBLVBTUy1TSEEyNTYAA2YKMiaRXE/7uyCJhaYy3wW9w5eaVCJM1YWJaWtuluqDAAAAAAAABzMwggcvMIIGF6ADAgECAhAFyWwpkw7zPE4+SRXBqdQLMA0GCSqGSIb3DQEBCwUAMFkxCzAJBgNVBAYTAlVTMRUwEwYDVQQKEwxEaWdpQ2VydCBJbmMxMzAxBgNVBAMTKkRpZ2lDZXJ0IEdsb2JhbCBHMiBUTFMgUlNBIFNIQTI1NiAyMDIwIENBMTAeFw0yNTA5MTMwMDAwMDBaFw0yNjA5MTUyMzU5NTlaMFgxCzAJBgNVBAYTAkZSMRwwGgYDVQQHExNJU1NZIExFUyBNT1VMSU5FQVVYMRIwEAYDVQQKEwlPcmFuZ2UgU0ExFzAVBgNVBAMTDmltYXAub3JhbmdlLmZyMIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEA026T5Eb35xpyll37+vU24MQyyu7EdyofwMh94QddMmKKwzIleB4c+Aojitzf6a/VuENQBrlqLT0tgWB+KZ37VRrarsT/SMPS72+bp6jcm3KdrbM+vzE2zszEUEoGOlokRSx18Gu1XcIJGei0vUxg7mRQwP7PpS5tD5p1eSpEZIWDsR46aDG0UaCLBXiKbvwSfEc3ZdVJrDykVG+2q4LaFQhkSCu3u91hiYqyvAe/R+EMVsPWyz398PipBQ2abxvMxY6dXfW602A+U3VZ4VZTZ9fFRIo/0c/BBmg1dWGIf8s6Ldgce217kvR9C6jqO+u2p8ja1tKd2uMRluhiEqHghwIDAQABo4ID8jCCA+4wHwYDVR0jBBgwFoAUdIWAwGbH3zfez70pN6oDHb7tzRcwHQYDVR0OBBYEFCslKm5umELOKAzQsrjkwILBv1Q7MIGDBgNVHREEfDB6gg5pbWFwLm9yYW5nZS5mcoIPaW1hcDQub3JhbmdlLmZygg9pbWFwLndhbmFkb28uZnKCDXBvcC5vcmFuZ2UuZnKCDnBvcC53YW5hZG9vLmZygg5wb3AzLm9yYW5nZS5mcoIXcG9wLm1haWxzYW50ZS5vcmFuZ2UuZnIwPgYDVR0gBDcwNTAzBgZngQwBAgIwKTAnBggrBgEFBQcCARYbaHR0cDovL3d3dy5kaWdpY2VydC5jb20vQ1BTMA4GA1UdDwEB/wQEAwIFoDAdBgNVHSUEFjAUBggrBgEFBQcDAQYIKwYBBQUHAwIwgZ8GA1UdHwSBlzCBlDBIoEagRIZCaHR0cDovL2NybDMuZGlnaWNlcnQuY29tL0RpZ2lDZXJ0R2xvYmFsRzJUTFNSU0FTSEEyNTYyMDIwQ0ExLTEuY3JsMEigRqBEhkJodHRwOi8vY3JsNC5kaWdpY2VydC5jb20vRGlnaUNlcnRHbG9iYWxHMlRMU1JTQVNIQTI1NjIwMjBDQTEtMS5jcmwwgYcGCCsGAQUFBwEBBHsweTAkBggrBgEFBQcwAYYYaHR0cDovL29jc3AuZGlnaWNlcnQuY29tMFEGCCsGAQUFBzAChkVodHRwOi8vY2FjZXJ0cy5kaWdpY2VydC5jb20vRGlnaUNlcnRHbG9iYWxHMlRMU1JTQVNIQTI1NjIwMjBDQTEtMS5jcnQwDAYDVR0TAQH/BAIwADCCAXsGCisGAQQB1nkCBAIEggFrBIIBZwFlAHUA2AlVO5RPev/IFhlvlE+Fq7D4/F6HVSYPFdEucrtFSxQAAAGZQ3BUZgAABAMARjBEAiAvIiKISf7c7TC6taytT06dnQtmI3wDBd33hvxWMSEx5gIgWY9h3kvzHMXBqnK+l4HM4bRVl6JpsMsaRvhL5IAzaf0AdQDCMX5XRRmjRe5/ON6ykEHrx8IhWiK/f9W1rXaa2Q5SzQAAAZlDcFRoAAAEAwBGMEQCIGbZmUgBMGUuXH/pC9kndwgdQlAylTJCztVxM7C7zuu/AiBV1Th33ttl/9gVkACniJXi+iaNacRtgIPcpA0edEevoQB1AJROQ4f67MHvgfMZJCaoGGUBx9NfOAIBP3JnfVU3LhnYAAABmUNwVIAAAAQDAEYwRAIgHouteUB84A9aRkVOR6kuXgQTK8qbimakRANUMKluXH4CIHTb/KYQkh2Z/jhacvBQcJP4Jo/3l6jdJQBdo5Hvu+04MA0GCSqGSIb3DQEBCwUAA4IBAQC4LsfDq6MKTV2Uu8G1YbAZv27siDjM+0enqzCip71QIvX8iQmGD/ONah0Qtzb+pU9noUP9yT7L/QmtMlinQ46Phbk/8/IuwPWWEQ712eKdWOCasGDLOtIgoKFBB8AM604k8k63aW1IoPexHKDOkSRf4Rwxc08gbgtj4pW1Bfjn/3xJRkImz+A/5BnTj/F4WojC+MhN2dcjiX6FMTVUCjIxxpRg9tN1KIoRGsQGNHXPUdNUEOu0o0HMG619TXaYEg/T91Am7HoyFA+7VA/2NyMobvYhNSkHi5khRvZRZCPeGMfdct8dPZg/wtADuWmaQA51lR1VkJbHwBjynYHDJ0AYZgoyJpFcT/u7IImFpjLfBb3Dl5pUIkzVhYlpa26W6oMAAAAAAAAE+DCCBPQwggPcoAMCAQICEAhflMAthXvozBT/U+2iPiowDQYJKoZIhvcNAQELBQAwYTELMAkGA1UEBhMCVVMxFTATBgNVBAoTDERpZ2lDZXJ0IEluYzEZMBcGA1UECxMQd3d3LmRpZ2ljZXJ0LmNvbTEgMB4GA1UEAxMXRGlnaUNlcnQgR2xvYmFsIFJvb3QgRzIwHhcNMjAwOTI0MDAwMDAwWhcNMzAwOTIzMjM1OTU5WjBZMQswCQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMTMwMQYDVQQDEypEaWdpQ2VydCBHbG9iYWwgRzIgVExTIFJTQSBTSEEyNTYgMjAyMCBDQTEwggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQDM9xBiT6a7Y2/tkFJWxW0ne3oSVorx9PnW5+GPvZWr8mBBFXDbEgD6Jwq1VzhbfbJRk3GVDmpBlFs1G/p7+rvFviQw/lbvxPN9l+MU9RRNy6cQ8hbqqyLwMSIRYWmQJrp42Zcf431mq3VElXPIrP/vXQqKWUPhrLI6D/NI/NdrN8Fj3N5G1ttF/n0j/ZDoUQceUaNf7UlGVH8siMX0E5yXFTwD6KE53GkMMsGvFldMlEdCfKLInH3m1E1Ur0KZqMEEwnec1kjkzhHgKoCZ8ENwzz92a9FMSaskXsINgv1GqKtsk8xiUkJ1kvia+l5esrBh5R8fuX8JmOg9+oN/R2mhAgMBAAGjggGuMIIBqjAdBgNVHQ4EFgQUdIWAwGbH3zfez70pN6oDHb7tzRcwHwYDVR0jBBgwFoAUTiJUIBiV5uNu5g/6+rkS7QYXjzkwDgYDVR0PAQH/BAQDAgGGMB0GA1UdJQQWMBQGCCsGAQUFBwMBBggrBgEFBQcDAjASBgNVHRMBAf8ECDAGAQH/AgEAMHYGCCsGAQUFBwEBBGowaDAkBggrBgEFBQcwAYYYaHR0cDovL29jc3AuZGlnaWNlcnQuY29tMEAGCCsGAQUFBzAChjRodHRwOi8vY2FjZXJ0cy5kaWdpY2VydC5jb20vRGlnaUNlcnRHbG9iYWxSb290RzIuY3J0MHsGA1UdHwR0MHIwN6A1oDOGMWh0dHA6Ly9jcmwzLmRpZ2ljZXJ0LmNvbS9EaWdpQ2VydEdsb2JhbFJvb3RHMi5jcmwwN6A1oDOGMWh0dHA6Ly9jcmw0LmRpZ2ljZXJ0LmNvbS9EaWdpQ2VydEdsb2JhbFJvb3RHMi5jcmwwMAYDVR0gBCkwJzAHBgVngQwBATAIBgZngQwBAgEwCAYGZ4EMAQICMAgGBmeBDAECAzANBgkqhkiG9w0BAQsFAAOCAQEAdYvAPFvv/3Bca4r1Ie+sMeZDPYCv11WpHsOOGGx50/esQt+PiMWdtHXzyQj9iv5R8/KdIBoENc74tkF5r//Mll6U05odcC6iMYv7pcx/Vt8XN5e/wY1DhquMZn657YvxD4y11FWvXIme4KcqbbKjYzIYO8vetZ+DsxEBrCANkJcStymcNbXXkQ7vQG9tXDu9odn74ssudkDSOrssvxYL6r0DW06YOirtBVAHFZM8czmRlFpIDsbTSgGvZjm5vUI0HNsIA/NA/BLorjyritX7cnlkpuMOVbE7lT+tYDNniqy2p1zw7VpSG9Rh4SUS5ge1qpSy8Cj2YSZeVRz4Aet3cWYKMiaRXE/7uyCJhaYy3wW9w5eaVCJM1YWJaWtuluqDAAAAAAAAA5IwggOOMIICdqADAgECAhADOvHmpxGpoLsoZLEdCfrlMA0GCSqGSIb3DQEBCwUAMGExCzAJBgNVBAYTAlVTMRUwEwYDVQQKEwxEaWdpQ2VydCBJbmMxGTAXBgNVBAsTEHd3dy5kaWdpY2VydC5jb20xIDAeBgNVBAMTF0RpZ2lDZXJ0IEdsb2JhbCBSb290IEcyMB4XDTEzMDgwMTEyMDAwMFoXDTM4MDExNTEyMDAwMFowYTELMAkGA1UEBhMCVVMxFTATBgNVBAoTDERpZ2lDZXJ0IEluYzEZMBcGA1UECxMQd3d3LmRpZ2ljZXJ0LmNvbTEgMB4GA1UEAxMXRGlnaUNlcnQgR2xvYmFsIFJvb3QgRzIwggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQC7N8003HtrybJokK1Kdf9GuiEKCI31GVTJ+4jb867yOomRPHrmqwYaa8+sLeheCSREumKaftajqH7gVHUgBaxQt5xjGmww3NofGbHXHt791+DLlIM3ruwfQ07deyzSvS6lL+SpuK061JmktiXpm2sAYJJg/08hSRj3Z5CrYQacj/K66bTpkjJrtfNX6F0bzYwdq5UElUnzNS2W40lt3Xfj+0lLtKxVB6mPlbO0I7tMbUXw9qmylTC0/UxVjCdKVxR8gp3Nc5LTFkoGDIxQ0Y8eCb4XoeYhyv2D5RC8g6UKxGco9nMUFD1GdsOHFIkhNE2vD0UMpkmhurucxbEzgymFAgMBAAGjQjBAMA8GA1UdEwEB/wQFMAMBAf8wDgYDVR0PAQH/BAQDAgGGMB0GA1UdDgQWBBROIlQgGJXm427mD/r6uRLtBhePOTANBgkqhkiG9w0BAQsFAAOCAQEAYGcolG8OSGPrMd3qZxjViX08xYtKf+m+2ysX37Bfc3cqMhM5gWdChCPyRWc17Ii/+I+wYQw0pK4gTITG2/g14XbZ36ZCu8dECIZ/NnQkWtpsDRRZNb3ySd22H8mzDUcqPZkvu1y7tdQg4ZlfU0YV22ib8PMw1T4x4o2EnuOK2tqWPjUTpV/w+XBQcEdBEVcZTsCPrgbElRMXLxsln3XysY6ZoW8TsUFx/ogqyE8QIFXX8xRF5eBE9OqHlTKTDv5TRvosnf+LIrlL2QlFpN6kuJpY3Rt9Up+OWUOIgaSeJtVvrd0Nxjd97QOSG+V3X3buPI3EXVZbotlmbrM1N+UytgAAAAEAAAAAAAEAAAAAJXRsc2ZsYWdzMHgwMDAwMDAwMDppbWFwLm9yYW5nZS5mcjo5OTMAAA==   Á¡