Return-Path: <bounce-23823255-4953320@pm.lameteonationale.com>
Received: from opme11d3d04nd1.nor.fr.intraorange ([10.79.5.102])
	by opme11d3b08nd1.nor.fr.intraorange with LMTP
	id uDnODZVKomKNCAAApnpmzw
	(envelope-from <bounce-23823255-4953320@pm.lameteonationale.com>); Thu, 09 Jun 2022 21:31:33 +0200
Received: from opme11ppr22nd1.nor.fr.intraorange ([10.79.5.102])
	by opme11d3d04nd1.nor.fr.intraorange with LMTP
	id oA+sDZVKomLbGgAAg4yjug
	(envelope-from <bounce-23823255-4953320@pm.lameteonationale.com>)
	for <MELOFR-200-jIRfDsq6shSq7o+X46PZ+b87jjyz6dFxAN9w3nnewhc=>; Thu, 09 Jun 2022 21:31:33 +0200
Received: from opmta1mti71nd1 ([10.79.5.102])
	by opme11ppr22nd1.nor.fr.intraorange with LMTP
	id qM9wDZVKomJ6GwAAkKo3Eg
	(envelope-from <bounce-23823255-4953320@pm.lameteonationale.com>)
	for <marc.malroux@orange.fr>; Thu, 09 Jun 2022 21:31:33 +0200
Received: from s7.pm.lameteonationale.com ([54.37.43.218])
	by smtp.orange.fr with ESMTP
	id zNsSnRpqmISXnzNsTnggyv; Thu, 09 Jun 2022 21:31:33 +0200
X-bcc: marc.malroux@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (17)(0000)gggruggvucftvghtrhhoucdtuddrgedvfedruddtledgudeffecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecuhedttdenucdnofetkffnkffpifculddujedmnecujfgurhepshfkfffuhfhrvfggtgfophfjjeesrgdtreerredtjeenucfhrhhomhepnfgrucforohtrohoucfprghtihhonhgrlhgvuceoihhnfhhosehpmhdrlhgrmhgvthgvohhnrghtihhonhgrlhgvrdgtohhmqeenucggtffrrghtthgvrhhnpeekkedvvefhkeekgffgieeuudfggfekuedulefhteelffeijeefffefueduteegkeenucffohhmrghinheplhgrmhgvthgvohhnrghtihhonhgrlhgvrdgtohhmpdhtrhgruggvughouhgslhgvrhdrtghomhdptghoughtrhhkfedrfhhrnecukfhppeehgedrfeejrdegfedrvddukeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopehsjedrphhmrdhlrghmvghtvghonhgrthhiohhnrghlvgdrtghomhdpihhnvghtpeehgedrfeejrdegfedrvddukedpmhgrihhlfhhrohhmpegsohhunhgtvgdqvdefkedvfedvheehqdegleehfeefvddtsehpmhdrlhgrmhgvthgvohhnrghtihhonhgrlhgvrdgtohhmpdhrtghpthhtohepmhgrrhgtrdhmrghlrhhouhigsehorhgrnhhgvgdrfhhrpdhnsggprhgtphhtthhopedu
X-me-spamlevel: not-spam
X-ME-Helo: s7.pm.lameteonationale.com
X-ME-IP: 54.37.43.218
X-ME-Entity: ofr
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=k2; d=pm.lameteonationale.com;
 h=Sender:Message-ID:Date:Subject:From:Reply-To:To:MIME-Version:Content-Type:
 List-Unsubscribe-Post:List-Unsubscribe:List-Id;
 i=bounce-23823255-4953320@pm.lameteonationale.com;
 bh=jjyAo6nAlFw5EP4ae1jEmNRddh3x/cila12UDllS3GA=;
 b=uKfNxqrLMfTV8tkcPpnnZ9lcj6NgRUu6o3DhBlrs+SWInzh0QgSFM0zyK9UFez+fZ96AIRTq1OYV
   ZhIj0eGlE0pv+8bpVKdE+fzE7Q8b+sTh0p6IRXC1YkemADUSr1h1LxaASqYkNyqvdlN/8yseOMrA
   Oj78PMorDMBomikJXB4=
Received: by s7.pm.lameteonationale.com id hk95982t21oc for <marc.malroux@orange.fr>; Thu, 9 Jun 2022 19:31:32 +0000 (envelope-from <bounce-23823255-4953320@pm.lameteonationale.com>)
Sender: bounce-23823255-4953320@pm.lameteonationale.com
Message-ID: <23823255-4953320@pm.lameteonationale.com>
Date: Thu, 09 Jun 2022 21:31:32 +0200
Subject: 09/06/2022 : Les =?utf-8?Q?pr=C3=A9visions_m=C3=A9t=C3=A9o?= du
 jour =?utf-8?Q?=C3=A0?= maurs
From: La =?utf-8?Q?M=C3=A9t=C3=A9o?= Nationale
 <info@pm.lameteonationale.com>
Reply-To: info@lameteonationale.com
To: marc.malroux@orange.fr
MIME-Version: 1.0
Content-Type: multipart/alternative;
 boundary="_=_swift_1654803092_e482b771a6467d5bba5ede5cd7679029_=_"
X-Mailer: SwiftMailer
Precedence: bulk
List-Unsubscribe-Post: List-Unsubscribe=One-Click
List-Unsubscribe: <mailto:unsubscribe-23823255-4953320-79-a85af732f629823e9f963f8304a29d91@lameteonationale.com>,
 <http://mld.lameteonationale.com/list-unsubscribe/23823255/4953320/79/a85af732f629823e9f963f8304a29d91>
List-Id: La =?utf-8?Q?M=C3=A9t=C3=A9o?= Nationale <meteonationale>
Feedback-ID: 4953320:lameteonationale


--_=_swift_1654803092_e482b771a6467d5bba5ede5cd7679029_=_
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Bonjour Marc,

 Votre newsletter La M=C3=A9t=C3=A9o Nationale vient d=
=E2=80=99arriver.

 Malheureusement, votre logiciel de messagerie ne pe=
ut pas lire cette newsletter. Il vous faut un logiciel compatible HTML.
=

 Pour le consulter en ligne : http://mld.lameteonationale.com/s/23823255=
-4953320/f81a325d79177def5f64c4c508a20718?mirrors%5Bcivility%5D=3Dmr&mirror=
s%5Bfirstname%5D=3DMarc&mirrors%5Blastname%5D=3DMalroux+&mirrors%5Bbirthday=
%5D=3D1972-07-08&mirrors%5Baddress%5D=3D3+rue+de+la+cote+de+dezes&mirrors%5=
Bzipcode%5D=3D15600&mirrors%5Bcity%5D=3Dmaurs&mirrors%5Bphone%5D=3D%2B33677=
808042&mirrors%5Bphone_type%5D=3Dmobile&mirrors%5Bcountry%5D=3Dfr
 Pour v=
ous d=C3=A9sabonner : http://mld.lameteonationale.com/unsubscribe?cid=3D495=
3320&email=3Dmarc.malroux%40orange.fr

 Merci.

--_=_swift_1654803092_e482b771a6467d5bba5ede5cd7679029_=_
Content-Type: text/html; charset=utf-8
Content-Transfer-Encoding: quoted-printable

<!DOCTYPE html PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN" "http://www.w=
3.org/TR/REC-html40/loose.dtd">
<html xmlns=3D"http://www.w3.org/1999/xht=
ml">
<head>
<meta http-equiv=3D"Content-Type" content=3D"text/html; cha=
rset=3Dutf-8">
<meta name=3D"viewport" content=3D"width=3Ddevice-width, i=
nitial-scale=3D1.0">
<!--[STYLE]--><style>.preheader{color: transparent;d=
isplay: none !important;height: 0;opacity: 0;visibility: hidden;width: 0;}<=
/style>
<style>@media only screen and (max-width:639px) {
  div.contain=
er {
    width: 100% !important;
    max-width: 100% !important;
    =
margin: 0 auto !important;
  }
  table.dmTableResponsive {
    min-wi=
dth: 100% !important;
    max-width: 100% !important;
    width: 100% !=
important;
  }
  .showDesktopHideMobile {
    display: none !importan=
t;
    overflow: hidden;
    width: 0 !important;
    max-width: 0 !i=
mportant;
    height: 0 !important;
    font-size: 0 !important;
    =
mso-hide: all !important;
  }
  .colon-xs-hidden {
    display: none =
!important;
    overflow: hidden;
    width: 0 !important;
    max-wi=
dth: 0 !important;
    height: 0 !important;
    font-size: 0 !importan=
t;
  }
  .colon-xs-10 {
    min-width: 10% !important;
    width: 1=
0% !important;
  }
  .colon-xs-80 {
    min-width: 80% !important;
=
    width: 80% !important;
  }
  .colon-xs-100 {
    display: block;=

    min-width: 100% !important;
    width: 100% !important;
    max-=
width: 320px !important;
  }
  .text-xs-16 {
    font-size: 16px !imp=
ortant;
    line-height: 20px !important;
  }
  .titre {
    font-s=
ize: 25px !important;
    line-height: 1.2 !important;
  }
  .sous-ti=
tre {
    font-size: 20px !important;
    line-height: 1.2 !important;=

  }
  .text-right {
    text-align: left !important;
  }
  img.d=
640m320 {
    display: block;
    width: 100% !important;
    max-wid=
th: 100% !important;
    margin: 0 auto;
  }
  img.d600m300 {
    d=
isplay: block;
    width: 100% !important;
    max-width: 100% !importa=
nt;
    margin: 0 auto;
  }
  img.d290m145 {
    display: block;
=
    width: 100% !important;
    max-width: 100% !important;
    margin:=
 0 auto;
  }
  table.spacer {
    min-width: 240px !important;
    =
max-width: 240px !important;
  }
  td.spacer {
    min-width: 240px !=
important;
    max-width: 240px !important;
  }
  .plr5mob {
    pa=
dding: 0 5px !important;
  }
  .w20 {
    display: block !important;=

    height: 30px !important;
  }
}


@media (prefers-color-sch=
eme: dark) {
  body {
    background: #000000 !important;
  }
  .da=
rkmode {
    background: #000000 !important;
  }
  .text-091043 {
 =
   color: #091043 !important;
  }
  .text-blanc {
    color: #FFFFFF =
!important;
  }
  .text-blanc-dkm {
    color: #FFFFFF !important;
=
  }
  .bg-blanc {
    background: #000000 !important;
  }
  .bg-bla=
nc-footer {
    background: #FFFFFF !important;
  }
  .bg-091043 {
=
    background: #091043 !important;
  }
  td.mobile-button-inverse-oran=
ge {
    color: #FFFFFF !important;
    background-color: #e64426 !impo=
rtant;
  }
}


@media (prefers-color-scheme: dark) {
  [data-og=
sc] body {
    background: #000000 !important;
  }
  [data-ogsc] .dar=
kmode {
    background: #000000 !important;
  }
  [data-ogsc] .text-0=
91043 {
    color: #091043 !important;
  }
  [data-ogsc] .text-blanc =
{
    color: #FFFFFF !important;
  }
  [data-ogsc] .text-blanc-dkm {=

    color: #FFFFFF !important;
  }
  [data-ogsc] .bg-blanc {
    b=
ackground: #000000 !important;
  }
  [data-ogsc] .bg-blanc-footer {
 =
   background: #FFFFFF !important;
  }
  [data-ogsc] .bg-091043 {
   =
 background: #091043 !important;
  }
  [data-ogsc] td.mobile-button-inv=
erse-orange {
    color: #FFFFFF !important;
    background-color: #e64=
426 !important;
  }
}


@media (prefers-color-scheme: dark) {
 =
 [data-ogsb] body {
    background: #000000 !important;
  }
  [data-o=
gsb] .darkmode {
    background: #000000 !important;
  }
  [data-ogsc=
] .text-091043 {
    color: #091043 !important;
  }
  [data-ogsb] .te=
xt-blanc {
    color: #FFFFFF !important;
  }
  [data-ogsb] .text-bla=
nc-dkm {
    color: #FFFFFF !important;
  }
  [data-ogsb] .bg-blanc {=

    background: #000000 !important;
  }
  [data-ogsb] .bg-blanc-foot=
er {
    background: #FFFFFF !important;
  }
  [data-ogsb] .bg-091043=
 {
    background: #091043 !important;
  }
  [data-ogsb] td.mobile-bu=
tton-inverse-orange {
    color: #FFFFFF !important;
    background-col=
or: #e64426 !important;
  }
}


@media only screen {
  @font-fa=
ce {
    font-family: 'Ubuntu';
    font-style: normal;
    font-weig=
ht: 400;
    font-display: swap;
    src: url(https://fonts.gstatic.com=
/s/ubuntu/v15/4iCs6KVjbNBYlgo6ew.woff) format('woff');
  }
  @font-face=
 {
    font-family: 'Ubuntu';
    font-style: normal;
    font-weight=
: 500;
    font-display: swap;
    src: url(https://fonts.gstatic.com/s=
/ubuntu/v15/4iCv6KVjbNBYlgoCjC3TtA.woff) format('woff');
  }
  @font-fa=
ce {
    font-family: 'Ubuntu';
    font-style: normal;
    font-weig=
ht: 700;
    font-display: swap;
    src: url(https://fonts.gstatic.com=
/s/ubuntu/v15/4iCv6KVjbNBYlgoCxCvTtA.woff) format('woff');
  }
}

=

@media only screen yahoo {
  * {
    overflow: visible !important;=

  }
  body {
    width: 640px;
    margin: 0 auto;
  }
  div.c=
ontainer {
    width: 640px;
    margin: 0 auto;
  }
}
</style>=

</head>
<body style=3D"width: 100% !important; -webkit-text-size-adjus=
t: 100%; -ms-text-size-adjust: 100%; margin-top: 0; margin-right: 0; margin=
-left: 0; margin-bottom: 0; padding-top: 0; padding-right: 0; padding-botto=
m: 0; padding-left: 0;">
<span class=3D"preheader" style=3D"color: transp=
arent;display: none !important;height: 0;opacity: 0;visibility: hidden;widt=
h: 0;">Les conditions m=C3=A9t=C3=A9o de votre ville et en France =C3=A0 co=
nsulter en un clin d'oeil</span>
    <table cellpadding=3D"0" cellspacing=
=3D"0" border=3D"0" align=3D"center" style=3D"background-color: #ffffff; ma=
rgin-bottom: 0; margin-top: 0; margin-right: 0; margin-left: 0; padding-lef=
t: 0; padding-top: 0; padding-bottom: 0; padding-right: 0; width: 100% !imp=
ortant;" bgcolor=3D"#ffffff">
<tr>
<td align=3D"center" height=3D"10"><=
span style=3D"font-size: xx-small; color: #999087; font-family: Verdana,Ari=
al,Helvetica,sans-serif;">Si vous ne parvenez pas =C3=A0 lire ce message, <=
a style=3D"color: #999087;" href=3D"http://mld.lameteonationale.com/s/23823=
255-4953320/f81a325d79177def5f64c4c508a20718?mirrors%5Bcivility%5D=3Dmr&amp=
;mirrors%5Bfirstname%5D=3DMarc&amp;mirrors%5Blastname%5D=3DMalroux+&amp;mir=
rors%5Bbirthday%5D=3D1972-07-08&amp;mirrors%5Baddress%5D=3D3+rue+de+la+cote=
+de+dezes&amp;mirrors%5Bzipcode%5D=3D15600&amp;mirrors%5Bcity%5D=3Dmaurs&am=
p;mirrors%5Bphone%5D=3D%2B33677808042&amp;mirrors%5Bphone_type%5D=3Dmobile&=
amp;mirrors%5Bcountry%5D=3Dfr" rel=3D"notracking" target=3D"_blank" data-ty=
pe=3D"tpl">consultez le en ligne</a></span></td>
      </tr>
<tr>
<td=
 align=3D"center" height=3D"30"><span style=3D"font-size: xx-small; color: =
#999087; font-family: Verdana,Arial,Helvetica,sans-serif;">Pour ne plus rec=
evoir de message, <a style=3D"color: #999087;" href=3D"http://mld.lameteona=
tionale.com/unsubscribe?cid=3D4953320&amp;email=3Dmarc.malroux%40orange.fr"=
 target=3D"_blank" rel=3D"notracking" data-type=3D"tpl">d=C3=A9sabonnez-vou=
s</a></span></td>
      </tr>
<tr>
<td align=3D"center"></td>
     =
 </tr>
<tr>
<td height=3D"5">=C2=A0</td>
      </tr>
<tr>
<td val=
ign=3D"top" align=3D"center" style=3D"border-collapse: collapse;">

   =
     <table width=3D"" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" ali=
gn=3D"center" style=3D"border-collapse: collapse; font-family: Arial, sans-=
serif; font-size: 14px; line-height: 16px; border: 1px solid #e1e3ea;">
<=
tr>
<td style=3D"border-bottom: 1px solid #e1e3ea;">
                <t=
able width=3D"100%" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" align=
=3D"center" style=3D"border-collapse: collapse;"><tr>
<td style=3D"paddin=
g: 25px 20px;" align=3D"left">
                        <img src=3D"http:/=
/mld.lameteonationale.com/r/08d2b24de69fe7a960db24b2b2473866/aHR0cHM6Ly9zdG=
F0aWMub3B0aW5hZmZpbGlhdGlvbi5jb20vbWFpbGluZy93ZWF0aGVyL2NvbW1vbi9sb2dvLmdpZ=
g" border=3D"0" alt=3D"" width=3D"116" height=3D"53" style=3D"display:block=
" class=3D"image_fix">
</td>
                    <td style=3D"padding: =
25px 0px; color: #f68b2d; font-size: 17px; line-height: 19px;font-weight: b=
old;" align=3D"center" valign=3D"bottom">
                        LA M=
=C3=89T=C3=89O DU JOUR
                    </td>
                    <t=
d style=3D"padding: 25px 20px; font-size: 14px;line-height: 16px;color: #22=
90b9;" align=3D"right" valign=3D"bottom">
                        Le 9 ju=
in 2022
                    </td>
                </tr></table>
</td>=

            </tr>
<tr>
<td>
                <table width=3D"650" b=
order=3D"0" cellpadding=3D"0" cellspacing=3D"0" align=3D"left" style=3D"bor=
der-collapse: collapse;"><tr>
<td style=3D"padding: 20px 20px;" align=3D"=
center">
                    <span><a href=3D"#" style=3D"text-decoration=
:none;font-weight:bold; color: #F68B2D;" data-type=3D"tpl"> &gt;&gt; Profit=
ez de l'offre du Jour &gt;&gt; </a></span>
                </td>
      =
          </tr></table>
</td>
            </tr>
<tr>
<td class=3D"w=
eather">
                <table width=3D"100%" border=3D"0" cellpadding=
=3D"0" cellspacing=3D"0" align=3D"center" style=3D"border-collapse: collaps=
e;color: #ffffff; font-size: 10px; mine-height: 12px;"><tr>
<td style=3D"=
background-color: #1770be;">
            <table width=3D"100%" border=3D"=
0" cellpadding=3D"0" cellspacing=3D"0" align=3D"center" style=3D"border-col=
lapse: collapse; font-size: 14px; line-height: 16px;">
<tr>
<td style=
=3D"padding-left: 20px;padding-top: 10px;">
                        <span=
 style=3D"font-size:20px; line-height: 22px;">Boisset</span><br>
        =
                Jeudi 16:00<br>
                        Nuageux<br>
</t=
d>
                </tr>
<tr>
<td style=3D"padding-left: 20px;" align=
=3D"bottom">
                        <table width=3D"" border=3D"0" cellp=
adding=3D"0" cellspacing=3D"0" align=3D"left" style=3D"border-collapse: col=
lapse;"><tr>
<td>
                                    <span style=3D" f=
ont-size: 70px; line-height: 72px;">14</span>
                           =
     </td>
                                <td valign=3D"top">
        =
                            <span style=3D"font-size:30px;line-height: 50px=
;">=C2=B0</span>
                                </td>
                =
                <td>
                                    <img src=3D"http=
://mld.lameteonationale.com/r/0f708b5390ca89f96392877749f82825/aHR0cHM6Ly9z=
dGF0aWMubWxkLmxhbWV0ZW9uYXRpb25hbGUuY29tL21haWxpbmcvd2VhdGhlci93aGl0ZS8wNG4=
ucG5n" border=3D"0" alt=3D"" width=3D"67" style=3D"" class=3D"">
</td>
=
                            </tr></table>
</td>
                </tr>=

</table>
</td>
                <td width=3D"64" style=3D"background-=
color: #489ee9;">
            <table width=3D"64" border=3D"0" cellpaddin=
g=3D"0" cellspacing=3D"0" align=3D"center" style=3D"border-collapse: collap=
se;">
<tr>
<td align=3D"center" style=3D"padding: 12px 0;">
         =
               3h - 5h
                    </td>
                </tr>=

<tr>
<td style=3D"" align=3D"center">
                        <img s=
rc=3D"http://mld.lameteonationale.com/r/0f708b5390ca89f96392877749f82825/aH=
R0cHM6Ly9zdGF0aWMubWxkLmxhbWV0ZW9uYXRpb25hbGUuY29tL21haWxpbmcvd2VhdGhlci93a=
Gl0ZS8wNG4ucG5n" border=3D"0" alt=3D"" width=3D"50" style=3D"display:block;=
" class=3D"image_fix">
</td>
                </tr>
<tr>
<td align=
=3D"center" style=3D"padding: 12px 0 20px;">
                        14=
=C2=B0C
                    </td>
                </tr>
</table>
</=
td>
                        <td width=3D"64" style=3D"background-color: #=
66b0f0;">
            <table width=3D"64" border=3D"0" cellpadding=3D"0" =
cellspacing=3D"0" align=3D"center" style=3D"border-collapse: collapse;">
=
<tr>
<td align=3D"center" style=3D"padding: 12px 0;">
                 =
       6h - 8h
                    </td>
                </tr>
<tr>=

<td style=3D"" align=3D"center">
                        <img src=3D"h=
ttp://mld.lameteonationale.com/r/0f708b5390ca89f96392877749f82825/aHR0cHM6L=
y9zdGF0aWMubWxkLmxhbWV0ZW9uYXRpb25hbGUuY29tL21haWxpbmcvd2VhdGhlci93aGl0ZS8w=
NG4ucG5n" border=3D"0" alt=3D"" width=3D"50" style=3D"display:block;" class=
=3D"image_fix">
</td>
                </tr>
<tr>
<td align=3D"cente=
r" style=3D"padding: 12px 0 20px;">
                        14=C2=B0C
 =
                   </td>
                </tr>
</table>
</td>
     =
                   <td width=3D"64" style=3D"background-color: #75bcf9;">=

            <table width=3D"64" border=3D"0" cellpadding=3D"0" cellspaci=
ng=3D"0" align=3D"center" style=3D"border-collapse: collapse;">
<tr>
<t=
d align=3D"center" style=3D"padding: 12px 0;">
                        9h=
 - 11h
                    </td>
                </tr>
<tr>
<td sty=
le=3D"" align=3D"center">
                        <img src=3D"http://mld.=
lameteonationale.com/r/0f708b5390ca89f96392877749f82825/aHR0cHM6Ly9zdGF0aWM=
ubWxkLmxhbWV0ZW9uYXRpb25hbGUuY29tL21haWxpbmcvd2VhdGhlci93aGl0ZS8wNG4ucG5n" =
border=3D"0" alt=3D"" width=3D"50" style=3D"display:block;" class=3D"image_=
fix">
</td>
                </tr>
<tr>
<td align=3D"center" style=
=3D"padding: 12px 0 20px;">
                        14=C2=B0C
         =
           </td>
                </tr>
</table>
</td>
             =
           <td width=3D"64" style=3D"background-color: #66b0f0;">
       =
     <table width=3D"64" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" a=
lign=3D"center" style=3D"border-collapse: collapse;">
<tr>
<td align=3D=
"center" style=3D"padding: 12px 0;">
                        12h - 14h
=
                    </td>
                </tr>
<tr>
<td style=3D"" a=
lign=3D"center">
                        <img src=3D"http://mld.lameteona=
tionale.com/r/0f708b5390ca89f96392877749f82825/aHR0cHM6Ly9zdGF0aWMubWxkLmxh=
bWV0ZW9uYXRpb25hbGUuY29tL21haWxpbmcvd2VhdGhlci93aGl0ZS8wNG4ucG5n" border=3D=
"0" alt=3D"" width=3D"50" style=3D"display:block;" class=3D"image_fix">
<=
/td>
                </tr>
<tr>
<td align=3D"center" style=3D"padding=
: 12px 0 20px;">
                        14=C2=B0C
                    =
</td>
                </tr>
</table>
</td>
                        =
<td width=3D"64" style=3D"background-color: #75bcf9;">
            <table=
 width=3D"64" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" align=3D"cen=
ter" style=3D"border-collapse: collapse;">
<tr>
<td align=3D"center" st=
yle=3D"padding: 12px 0;">
                        15h - 17h
           =
         </td>
                </tr>
<tr>
<td style=3D"" align=3D"cen=
ter">
                        <img src=3D"http://mld.lameteonationale.com=
/r/0f708b5390ca89f96392877749f82825/aHR0cHM6Ly9zdGF0aWMubWxkLmxhbWV0ZW9uYXR=
pb25hbGUuY29tL21haWxpbmcvd2VhdGhlci93aGl0ZS8wNG4ucG5n" border=3D"0" alt=3D"=
" width=3D"50" style=3D"display:block;" class=3D"image_fix">
</td>
    =
            </tr>
<tr>
<td align=3D"center" style=3D"padding: 12px 0 20=
px;">
                        14=C2=B0C
                    </td>
   =
             </tr>
</table>
</td>
                        <td width=
=3D"64" style=3D"background-color: #66b0f0;">
            <table width=3D=
"64" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" align=3D"center" styl=
e=3D"border-collapse: collapse;">
<tr>
<td align=3D"center" style=3D"pa=
dding: 12px 0;">
                        18h - 20h
                    =
</td>
                </tr>
<tr>
<td style=3D"" align=3D"center">
 =
                       <img src=3D"http://mld.lameteonationale.com/r/0f708b=
5390ca89f96392877749f82825/aHR0cHM6Ly9zdGF0aWMubWxkLmxhbWV0ZW9uYXRpb25hbGUu=
Y29tL21haWxpbmcvd2VhdGhlci93aGl0ZS8wNG4ucG5n" border=3D"0" alt=3D"" width=
=3D"50" style=3D"display:block;" class=3D"image_fix">
</td>
           =
     </tr>
<tr>
<td align=3D"center" style=3D"padding: 12px 0 20px;">=

                        14=C2=B0C
                    </td>
        =
        </tr>
</table>
</td>
                        <td width=3D"64"=
 style=3D"background-color: #489ee9;">
            <table width=3D"64" bo=
rder=3D"0" cellpadding=3D"0" cellspacing=3D"0" align=3D"center" style=3D"bo=
rder-collapse: collapse;">
<tr>
<td align=3D"center" style=3D"padding: =
12px 0;">
                        21h - 23h
                    </td>=

                </tr>
<tr>
<td style=3D"" align=3D"center">
      =
                  <img src=3D"http://mld.lameteonationale.com/r/a8510f4b964=
7dfd6659beececf5457e5/aHR0cHM6Ly9zdGF0aWMubWxkLmxhbWV0ZW9uYXRpb25hbGUuY29tL=
21haWxpbmcvd2VhdGhlci93aGl0ZS8wM24ucG5n" border=3D"0" alt=3D"" width=3D"50"=
 style=3D"display:block;" class=3D"image_fix">
</td>
                </=
tr>
<tr>
<td align=3D"center" style=3D"padding: 12px 0 20px;">
      =
                  11=C2=B0C
                    </td>
                <=
/tr>
</table>
</td>
            </tr></table>
</td>
            <=
/tr>
<tr>
<td>
                <table border=3D"0" cellpadding=3D"0" =
cellspacing=3D"0" align=3D"center" style=3D"border-collapse: collapse;"><tr=
>
<td style=3D"padding: 10px 20px;">
                    <!--[CONTENT]-=
-><table width=3D"100%" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" al=
ign=3D"center" style=3D"border-collapse: collapse;"><tbody><tr>
<td align=
=3D"center">
   =20
        <div class=3D"container darkmode" style=3D"ma=
rgin: 0 auto !important; max-width: 640px !important; width: 100% !importan=
t;">
            <center class=3D"darkmode">
                <!--[if (g=
te mso 9)|(IE)]>
            <table width=3D"640" align=3D"center" cellpa=
dding=3D"0" cellspacing=3D"0" style=3D"width:640px">
              <tr>=

                <td>
                <![endif]-->
                <t=
able border=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"dmTableRespo=
nsive" role=3D"presentation" width=3D"100%" style=3D"Margin: 0 auto; border=
-collapse: collapse; border-spacing: 0; box-sizing: border-box; margin: 0 a=
uto; max-width: 640px; min-width: 640px; mso-table-lspace: 0pt; mso-table-r=
space: 0pt; padding: 0; table-layout: fixed; width: 640px;"><tbody><tr>
<=
td align=3D"center" valign=3D"top" style=3D"-moz-hyphens: auto; -webkit-hyp=
hens: auto; Margin: 0; border-collapse: collapse; box-sizing: border-box; h=
yphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padd=
ing: 0; word-wrap: break-word;">
                            <center>
 =
                               <!-- SECTION PRE HEADER MIROIR -->
       =
                         <table align=3D"center" bgcolor=3D"#F0F0F0" border=
=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"dmTableResponsive" role=
=3D"presentation" width=3D"100%" style=3D"Margin: 0 auto; border-collapse: =
collapse; border-spacing: 0; box-sizing: border-box; margin: 0 auto; max-wi=
dth: 640px; min-width: 640px; mso-table-lspace: 0pt; mso-table-rspace: 0pt;=
 padding: 0; table-layout: fixed; width: 640px;"><tbody><tr>
<td align=3D=
"center" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; bor=
der-collapse: collapse; box-sizing: border-box; hyphens: auto; margin: 0; m=
so-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: break-w=
ord;">
                                            <table border=3D"0" ce=
llpadding=3D"0" cellspacing=3D"0" class=3D"spacer" role=3D"presentation" wi=
dth=3D"100%" style=3D"Margin: 0 auto; border-collapse: collapse; border-spa=
cing: 0; box-sizing: border-box; margin: 0 auto; max-width: 640px; mso-tabl=
e-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; table-layout: auto; width=
: 100%;"><tbody><tr>
<td height=3D"15" style=3D"-moz-hyphens: auto; -webk=
it-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: border-=
box; font-size: 15px; height: 15px; hyphens: auto; line-height: 15px; margi=
n: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: =
break-word;">=C2=A0</td>
                                                =
</tr></tbody></table>
<table border=3D"0" cellpadding=3D"0" cellspacing=
=3D"0" class=3D"dmTableResponsive" role=3D"presentation" width=3D"100%" sty=
le=3D"Margin: 0 auto; border-collapse: collapse; border-spacing: 0; box-siz=
ing: border-box; margin: 0 auto; max-width: 640px; min-width: 640px; mso-ta=
ble-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; table-layout: auto; wid=
th: 640px;"><tbody><tr>
<td align=3D"center" class=3D"text-center" valign=
=3D"top" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; bor=
der-collapse: collapse; box-sizing: border-box; hyphens: auto; margin: 0; m=
so-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; text-align: center=
; word-wrap: break-word;">
                                              =
          <p class=3D"preheader" style=3D"-ms-hyphens: none; -webkit-hyphen=
s: none; Margin: 0; color: #343e48; display: none !important; font-size: 0p=
x; hyphens: none; line-height: 0px; margin: 0; max-height: 0px; max-width: =
0px; mso-hide: all !important; opacity: 0; overflow: hidden; padding: 0; vi=
sibility: hidden;"></p>
                                                 =
   </td>
                                                </tr></tbody></t=
able>
<table border=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"dm=
TableResponsive" role=3D"presentation" width=3D"100%" style=3D"Margin: 0 au=
to; border-collapse: collapse; border-spacing: 0; box-sizing: border-box; m=
argin: 0 auto; max-width: 640px; min-width: 640px; mso-table-lspace: 0pt; m=
so-table-rspace: 0pt; padding: 0; table-layout: auto; width: 640px;"><tbody=
><tr>
<td align=3D"center" class=3D"text-center" valign=3D"top" style=3D"=
-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: coll=
apse; box-sizing: border-box; hyphens: auto; margin: 0; mso-table-lspace: 0=
pt; mso-table-rspace: 0pt; padding: 0; text-align: center; word-wrap: break=
-word;">
                                                        <p class=
=3D"text-md-12 text-a8a8a8 plr20" style=3D"-ms-hyphens: none; -webkit-hyphe=
ns: none; Margin: 0; color: #a8a8a8; font-size: 12px; font-weight: normal; =
hyphens: none; line-height: 16px; margin: 0; padding: 0 20px;">NOUVEAU SUV =
C5 AIRCROSS SUV HYBRIDE RECHARGEABLE=C2=A0: UNE NOUVELLE D=C3=89FINITION DU=
 CONFORT</p>
                                                    </td>
=
                                                </tr></tbody></table>
<ta=
ble border=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"spacer" role=
=3D"presentation" width=3D"100%" style=3D"Margin: 0 auto; border-collapse: =
collapse; border-spacing: 0; box-sizing: border-box; margin: 0 auto; max-wi=
dth: 640px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; table=
-layout: auto; width: 100%;"><tbody><tr>
<td height=3D"15" style=3D"-moz-=
hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: collapse;=
 box-sizing: border-box; font-size: 15px; height: 15px; hyphens: auto; line=
-height: 15px; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; pad=
ding: 0; word-wrap: break-word;">=C2=A0</td>
                            =
                    </tr></tbody></table>
</td>
                       =
             </tr></tbody></table>
<!-- //SECTION PRE HEADER MIROIR --><!=
-- SECTION VISU PRINCIPAL --><table align=3D"center" bgcolor=3D"#FFFFFF" bo=
rder=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"dmTableResponsive b=
g-blanc" role=3D"presentation" width=3D"100%" style=3D"Margin: 0 auto; back=
ground: #FFFFFF; border-collapse: collapse; border-spacing: 0; box-sizing: =
border-box; margin: 0 auto; max-width: 640px; min-width: 640px; mso-table-l=
space: 0pt; mso-table-rspace: 0pt; padding: 0; table-layout: fixed; width: =
640px;"><tbody><tr>
<td align=3D"center" style=3D"-moz-hyphens: auto; -we=
bkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: borde=
r-box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0=
pt; padding: 0; word-wrap: break-word;"><a href=3D"http://mld.lameteonation=
ale.com/c/23823255-4953320/f81a325d79177def5f64c4c508a20718/aHR0cHM6Ly9jbGs=
udHJhZGVkb3VibGVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDAmZz0yNTIzNDk1NCZ1cm=
w9aHR0cHM6Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaWVuPXYxJl9wZXJzbz0x"=
 target=3D"_blank" style=3D"background: initial; color: #a8a8a8; mso-style-=
priority: 99; padding-right: initial; text-decoration: none;"><img alt=3D"N=
OUVEAU SUV citro=C3=ABn C3 AIRCROSS" class=3D"d640m320" src=3D"http://mld.l=
ameteonationale.com/r/cd3eb95313d8be7991138fefdbc91178/aHR0cHM6Ly9oc3QudHJh=
ZGVkb3VibGVyLmNvbS9maWxlLzMyOTg5Ni9pbWFnZXMvaW1nLW1haW4ucG5n" width=3D"640"=
 style=3D"-ms-interpolation-mode: bicubic; border: 0; display: block; margi=
n: 0 auto; max-width: 640px; outline: none; text-decoration: none; width: 1=
00%;"></a></td>
                                    </tr></tbody></table>=

<!-- //SECTION VISU PRINCIPAL --><!-- SECTION INTRO --><table align=3D"c=
enter" bgcolor=3D"#FFFFFF" border=3D"0" cellpadding=3D"0" cellspacing=3D"0"=
 class=3D"dmTableResponsive bg-blanc" role=3D"presentation" width=3D"100%" =
style=3D"Margin: 0 auto; background: #FFFFFF; border-collapse: collapse; bo=
rder-spacing: 0; box-sizing: border-box; margin: 0 auto; max-width: 640px; =
min-width: 640px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0;=
 table-layout: fixed; width: 640px;"><tbody>
<tr>
<td align=3D"center" =
style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-colla=
pse: collapse; box-sizing: border-box; hyphens: auto; margin: 0; mso-table-=
lspace: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: break-word;">
=
                                            <p class=3D"titre text-091043" =
style=3D"-ms-hyphens: none; -webkit-hyphens: none; Margin: 0; color: #09104=
3; font-size: 30px; font-weight: bold; hyphens: none; line-height: 1.2; mar=
gin: 0; padding: 0; text-transform: uppercase;"><span class=3D"text-091043"=
 style=3D"-ms-hyphens: none; -webkit-hyphens: none; Margin: 0; color: #0910=
43; hyphens: none; margin: 0; padding: 0;">Une nouvelle d=C3=A9finition<br>=
 du confort</span></p>
                                        </td>
  =
                                  </tr>
<tr>
<td height=3D"35" style=3D=
"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: col=
lapse; box-sizing: border-box; font-size: 35px; height: 35px; hyphens: auto=
; line-height: 35px; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0p=
t; padding: 0; word-wrap: break-word;">=C2=A0</td>
                      =
              </tr>
<tr>
<td align=3D"center" class=3D"plr20" style=3D"=
-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: coll=
apse; box-sizing: border-box; hyphens: auto; margin: 0; mso-table-lspace: 0=
pt; mso-table-rspace: 0pt; padding: 0 20px; word-wrap: break-word;">
    =
                                        <p class=3D"text-md-18 text-xs-16 t=
ext-blanc-dkm" style=3D"-ms-hyphens: none; -webkit-hyphens: none; Margin: 0=
; font-size: 18px; font-weight: normal; hyphens: none; line-height: 22px; m=
argin: 0; padding: 0;">Avec un design enti=C3=A8rement revisit=C3=A9, Nouve=
au SUV C5 Aircross offre =C3=A0 tous ses occupants un voyage dans un confor=
t absolu.</p>
                                        </td>
           =
                         </tr>
<tr>
<td height=3D"40" style=3D"-moz-hyp=
hens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: collapse; bo=
x-sizing: border-box; font-size: 40px; height: 40px; hyphens: auto; line-he=
ight: 40px; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; paddin=
g: 0; word-wrap: break-word;">=C2=A0</td>
                               =
     </tr>
<tr>
<td align=3D"center" style=3D"-moz-hyphens: auto; -webk=
it-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: border-=
box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt=
; padding: 0; word-wrap: break-word;">
                                  =
          <table align=3D"center" bgcolor=3D"#FFFFFF" border=3D"0" cellpadd=
ing=3D"0" cellspacing=3D"0" class=3D"dmTableResponsive bg-blanc" role=3D"pr=
esentation" width=3D"100%" style=3D"Margin: 0 auto; background: #FFFFFF; bo=
rder-collapse: collapse; border-spacing: 0; box-sizing: border-box; margin:=
 0 auto; max-width: 640px; min-width: 640px; mso-table-lspace: 0pt; mso-tab=
le-rspace: 0pt; padding: 0; table-layout: auto; width: 640px;"><tbody><tr>=

<td align=3D"center" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto;=
 Margin: 0; border-collapse: collapse; box-sizing: border-box; hyphens: aut=
o; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; wor=
d-wrap: break-word;">
                                                   =
     <table border=3D"0" cellpadding=3D"0" cellspacing=3D"0" role=3D"presen=
tation" style=3D"Margin: 0 auto; border-collapse: collapse; border-spacing:=
 0; box-sizing: border-box; margin: 0 auto; mso-table-lspace: 0pt; mso-tabl=
e-rspace: 0pt; table-layout: auto;"><tbody><tr>
<td align=3D"center" bgco=
lor=3D"#e64426" class=3D"mobile-button-inverse-orange" valign=3D"middle" st=
yle=3D"-moz-box-sizing: border-box; -moz-hyphens: auto; -webkit-box-sizing:=
 border-box; -webkit-hyphens: auto; Margin: 0; background-color: #e64426; b=
order-collapse: collapse; box-sizing: border-box; color: #FFFFFF; display: =
inline-block; font-family: 'Ubuntu', Arial, sans-serif; font-size: 20px; fo=
nt-weight: 400; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-=
rspace: 0pt; padding: 13px 30px; vertical-align: middle; width: auto; word-=
wrap: break-word;">
                                                     =
               <table border=3D"0" cellpadding=3D"0" cellspacing=3D"0" styl=
e=3D"Margin: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizi=
ng: border-box; margin: 0 auto; mso-table-lspace: 0pt; mso-table-rspace: 0p=
t; table-layout: auto; width: auto;"><tbody><tr>
<td align=3D"center" val=
ign=3D"middle" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: =
0; border-collapse: collapse; box-sizing: border-box; hyphens: auto; margin=
: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: b=
reak-word;"><a class=3D"text-blanc text-underline-none text-md-20 text-xs-1=
6" href=3D"http://mld.lameteonationale.com/c/23823255-4953320/f81a325d79177=
def5f64c4c508a20718/aHR0cHM6Ly9jbGsudHJhZGVkb3VibGVyLmNvbS9jbGljaz9wPTMyOTg=
5NiZhPTIyNzM1NDAmZz0yNTIzNDk1NCZ1cmw9aHR0cHM6Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl=
8zMzQ5My8lM0ZsaWVuPXYxJl9wZXJzbz0x" target=3D"_blank" style=3D"background: =
initial; color: #FFFFFF; font-size: 20px; font-weight: normal; line-height:=
 24px; mso-style-priority: 99; padding-right: initial; text-decoration: non=
e;"><span class=3D"text-blanc text-underline-none" style=3D"-ms-hyphens: no=
ne; -webkit-hyphens: none; Margin: 0; color: #FFFFFF; hyphens: none; margin=
: 0; padding: 0; text-decoration: none;">DEMANDER UNE OFFRE=C2=A0=C2=A0</sp=
an></a></td>
                                                            =
                <td align=3D"center" valign=3D"middle" width=3D"11" style=
=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: =
collapse; box-sizing: border-box; hyphens: auto; margin: 0; mso-table-lspac=
e: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: break-word;"><a class=
=3D"text-right inline-block" href=3D"http://mld.lameteonationale.com/c/2382=
3255-4953320/f81a325d79177def5f64c4c508a20718/aHR0cHM6Ly9jbGsudHJhZGVkb3Vib=
GVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDAmZz0yNTIzNDk1NCZ1cmw9aHR0cHM6Ly9j=
b2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaWVuPXYxJl9wZXJzbz0x" target=3D"_bl=
ank" style=3D"background: initial; color: #a8a8a8; display: inline-block !i=
mportant; mso-style-priority: 99; padding-right: initial; text-align: right=
; text-decoration: none;"><img height=3D"20" role=3D"presentation" src=3D"h=
ttp://mld.lameteonationale.com/r/22deac440eff7ed5d4522a1a6f6007be/aHR0cHM6L=
y9oc3QudHJhZGVkb3VibGVyLmNvbS9maWxlLzMyOTg5Ni9pbWFnZXMvY2hldnJvbi1jdGEucG5n=
" width=3D"11" style=3D"-ms-interpolation-mode: bicubic; border: 0; display=
: block; outline: none; text-decoration: none;" alt=3D""></a></td>
      =
                                                                  </tr></tb=
ody></table>
</td>
                                                    =
        </tr></tbody></table>
</td>
                                   =
             </tr></tbody></table>
<table border=3D"0" cellpadding=3D"0" =
cellspacing=3D"0" class=3D"spacer" role=3D"presentation" width=3D"100%" sty=
le=3D"Margin: 0 auto; border-collapse: collapse; border-spacing: 0; box-siz=
ing: border-box; margin: 0 auto; max-width: 640px; mso-table-lspace: 0pt; m=
so-table-rspace: 0pt; padding: 0; table-layout: auto; width: 100%;"><tbody>=
<tr>
<td height=3D"50" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto=
; Margin: 0; border-collapse: collapse; box-sizing: border-box; font-size: =
50px; height: 50px; hyphens: auto; line-height: 50px; margin: 0; mso-table-=
lspace: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: break-word;">=
=C2=A0</td>
                                                </tr></tbody>=
</table>
</td>
                                    </tr>
</tbody></ta=
ble>
<!-- //SECTION INTRO --><!-- SECTION TRANCHE 1 --><table align=3D"ce=
nter" bgcolor=3D"#FFFFFF" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" =
class=3D"dmTableResponsive bg-blanc" role=3D"presentation" width=3D"100%" s=
tyle=3D"Margin: 0 auto; background: #FFFFFF; border-collapse: collapse; bor=
der-spacing: 0; box-sizing: border-box; margin: 0 auto; max-width: 640px; m=
in-width: 640px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; =
table-layout: fixed; width: 640px;"><tbody><tr>
<td style=3D"-moz-hyphens=
: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-si=
zing: border-box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-tabl=
e-rspace: 0pt; padding: 0; word-wrap: break-word;">
                     =
                       <table align=3D"center" border=3D"0" cellpadding=3D"=
0" cellspacing=3D"0" class=3D"dmTableResponsive" role=3D"presentation" widt=
h=3D"100%" style=3D"Margin: 0 auto; border-collapse: collapse; border-spaci=
ng: 0; box-sizing: border-box; margin: 0 auto; max-width: 640px; min-width:=
 640px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; table-lay=
out: auto; width: 640px;"><tbody><tr>
<td class=3D"w20" width=3D"20" styl=
e=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse:=
 collapse; box-sizing: border-box; hyphens: auto; margin: 0; max-width: 20p=
x; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; width: 3.125%;=
 word-wrap: break-word;">=C2=A0</td>
                                    =
                <td class=3D"text-left w290" valign=3D"top" width=3D"290" s=
tyle=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collap=
se: collapse; box-sizing: border-box; hyphens: auto; margin: 0; max-width: =
290px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; text-align=
: left; width: 45.3125%; word-wrap: break-word;">
                       =
                                 <table align=3D"center" border=3D"0" cellp=
adding=3D"0" cellspacing=3D"0" role=3D"presentation" style=3D"Margin: 0 aut=
o; border-collapse: collapse; border-spacing: 0; box-sizing: border-box; ma=
rgin: 0 auto; mso-table-lspace: 0pt; mso-table-rspace: 0pt; table-layout: a=
uto;"><tbody><tr>
<td align=3D"center" style=3D"-moz-hyphens: auto; -webk=
it-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: border-=
box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt=
; padding: 0; word-wrap: break-word;">
                                  =
                                  <table align=3D"center" border=3D"0" cell=
padding=3D"0" cellspacing=3D"0" role=3D"presentation" style=3D"Margin: 0 au=
to; border-collapse: collapse; border-spacing: 0; box-sizing: border-box; m=
argin: 0 auto; mso-table-lspace: 0pt; mso-table-rspace: 0pt; table-layout: =
auto;"><tbody>
<tr>
<td align=3D"center" style=3D"-moz-hyphens: auto; -=
webkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: bor=
der-box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspace:=
 0pt; padding: 0; word-wrap: break-word;"><a href=3D"http://mld.lameteonati=
onale.com/c/23823255-4953320/f81a325d79177def5f64c4c508a20718/aHR0cHM6Ly9jb=
GsudHJhZGVkb3VibGVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDAmZz0yNTIzNDk1NCZ1=
cmw9aHR0cHM6Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaWVuPXYxJl9wZXJzbz0=
x" target=3D"_blank" style=3D"background: initial; color: #a8a8a8; mso-styl=
e-priority: 99; padding-right: initial; text-decoration: none;"><img class=
=3D"d290m145" role=3D"presentation" src=3D"http://mld.lameteonationale.com/=
r/19e286fe840749d527f8d47970c4c8d2/aHR0cHM6Ly9oc3QudHJhZGVkb3VibGVyLmNvbS9m=
aWxlLzMyOTg5Ni9pbWFnZXMvc3BlYzAxLnBuZw" width=3D"290" style=3D"-ms-interpol=
ation-mode: bicubic; border: 0; display: block; margin: 0 auto; max-width: =
290px; outline: none; text-decoration: none; width: 100%;" alt=3D""></a></t=
d>
                                                                      =
  </tr>
<tr>
<td height=3D"15" style=3D"-moz-hyphens: auto; -webkit-hyp=
hens: auto; Margin: 0; border-collapse: collapse; box-sizing: border-box; f=
ont-size: 15px; height: 15px; hyphens: auto; line-height: 15px; margin: 0; =
mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: break-=
word;">=C2=A0</td>
                                                      =
                  </tr>
<tr>
<td align=3D"center" valign=3D"top" style=
=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: =
collapse; box-sizing: border-box; hyphens: auto; margin: 0; mso-table-lspac=
e: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: break-word;">
     =
                                                                           =
<p class=3D"sous-titre text-091043" style=3D"-ms-hyphens: none; -webkit-hyp=
hens: none; Margin: 0; color: #091043; font-size: 25px; font-weight: bold; =
hyphens: none; line-height: 1.2; margin: 0; padding: 0; text-transform: upp=
ercase;"><a class=3D"text-091043 text-underline-none" href=3D"http://mld.la=
meteonationale.com/c/23823255-4953320/f81a325d79177def5f64c4c508a20718/aHR0=
cHM6Ly9jbGsudHJhZGVkb3VibGVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDAmZz0yNTI=
zNDk1NCZ1cmw9aHR0cHM6Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaWVuPXYxJl=
9wZXJzbz0x" target=3D"_blank" style=3D"background: initial; color: #091043;=
 mso-style-priority: 99; padding-right: initial; text-decoration: none;"><s=
pan class=3D"text-091043 text-underline-none" style=3D"-ms-hyphens: none; -=
webkit-hyphens: none; Margin: 0; color: #091043; hyphens: none; margin: 0; =
padding: 0; text-decoration: none;">une personnalit=C3=A9<br> affirm=C3=
=A9e</span></a></p>
                                                     =
                       </td>
                                            =
                            </tr>
</tbody></table>
</td>
            =
                                                </tr></tbody></table>
</t=
d>
                                                    <td class=3D"w20" =
width=3D"20" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0;=
 border-collapse: collapse; box-sizing: border-box; hyphens: auto; margin: =
0; max-width: 20px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: =
0; width: 3.125%; word-wrap: break-word;">=C2=A0</td>
                   =
                                 <td class=3D"text-left w290" valign=3D"top=
" width=3D"290" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin:=
 0; border-collapse: collapse; box-sizing: border-box; hyphens: auto; margi=
n: 0; max-width: 290px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; paddi=
ng: 0; text-align: left; width: 45.3125%; word-wrap: break-word;">
      =
                                                  <table align=3D"center" b=
order=3D"0" cellpadding=3D"0" cellspacing=3D"0" role=3D"presentation" style=
=3D"Margin: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizin=
g: border-box; margin: 0 auto; mso-table-lspace: 0pt; mso-table-rspace: 0pt=
; table-layout: auto;"><tbody><tr>
<td align=3D"center" style=3D"-moz-hyp=
hens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: collapse; bo=
x-sizing: border-box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-=
table-rspace: 0pt; padding: 0; word-wrap: break-word;">
                 =
                                                   <table align=3D"center" =
border=3D"0" cellpadding=3D"0" cellspacing=3D"0" role=3D"presentation" styl=
e=3D"Margin: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizi=
ng: border-box; margin: 0 auto; mso-table-lspace: 0pt; mso-table-rspace: 0p=
t; table-layout: auto;"><tbody>
<tr>
<td align=3D"center" style=3D"-moz=
-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: collapse=
; box-sizing: border-box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; =
mso-table-rspace: 0pt; padding: 0; word-wrap: break-word;"><a href=3D"http:=
//mld.lameteonationale.com/c/23823255-4953320/f81a325d79177def5f64c4c508a20=
718/aHR0cHM6Ly9jbGsudHJhZGVkb3VibGVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDA=
mZz0yNTIzNDk1NCZ1cmw9aHR0cHM6Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaW=
VuPXYxJl9wZXJzbz0x" target=3D"_blank" style=3D"background: initial; color: =
#a8a8a8; mso-style-priority: 99; padding-right: initial; text-decoration: n=
one;"><img class=3D"d290m145" role=3D"presentation" src=3D"http://mld.lamet=
eonationale.com/r/8d8b0a8cffe00a9e889b7bf030371187/aHR0cHM6Ly9oc3QudHJhZGVk=
b3VibGVyLmNvbS9maWxlLzMyOTg5Ni9pbWFnZXMvc3BlYzAyLnBuZw" width=3D"290" style=
=3D"-ms-interpolation-mode: bicubic; border: 0; display: block; margin: 0 a=
uto; max-width: 290px; outline: none; text-decoration: none; width: 100%;" =
alt=3D""></a></td>
                                                      =
                  </tr>
<tr>
<td height=3D"15" style=3D"-moz-hyphens: a=
uto; -webkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizin=
g: border-box; font-size: 15px; height: 15px; hyphens: auto; line-height: 1=
5px; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; w=
ord-wrap: break-word;">=C2=A0</td>
                                      =
                                  </tr>
<tr>
<td align=3D"center" valig=
n=3D"top" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; bo=
rder-collapse: collapse; box-sizing: border-box; hyphens: auto; margin: 0; =
mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: break-=
word;">
                                                                 =
               <p class=3D"sous-titre text-091043" style=3D"-ms-hyphens: no=
ne; -webkit-hyphens: none; Margin: 0; color: #091043; font-size: 25px; font=
-weight: bold; hyphens: none; line-height: 1.2; margin: 0; padding: 0; text=
-transform: uppercase;"><a class=3D"text-091043 text-underline-none" href=
=3D"http://mld.lameteonationale.com/c/23823255-4953320/f81a325d79177def5f64=
c4c508a20718/aHR0cHM6Ly9jbGsudHJhZGVkb3VibGVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPT=
IyNzM1NDAmZz0yNTIzNDk1NCZ1cmw9aHR0cHM6Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5M=
y8lM0ZsaWVuPXYxJl9wZXJzbz0x" target=3D"_blank" style=3D"background: initial=
; color: #091043; mso-style-priority: 99; padding-right: initial; text-deco=
ration: none;"><span class=3D"text-091043 text-underline-none" style=3D"-ms=
-hyphens: none; -webkit-hyphens: none; Margin: 0; color: #091043; hyphens: =
none; margin: 0; padding: 0; text-decoration: none;">un confort et un
   =
                                                                           =
              silence exemplaires</span></a></p>
                        =
                                                    </td>
               =
                                                         </tr>
</tbody></=
table>
</td>
                                                          =
  </tr></tbody></table>
</td>
                                         =
           <td class=3D"w20" width=3D"20" style=3D"-moz-hyphens: auto; -web=
kit-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: border=
-box; hyphens: auto; margin: 0; max-width: 20px; mso-table-lspace: 0pt; mso=
-table-rspace: 0pt; padding: 0; width: 3.125%; word-wrap: break-word;">=
=C2=A0</td>
                                                </tr></tbody>=
</table>
<table border=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D=
"spacer" role=3D"presentation" width=3D"100%" style=3D"Margin: 0 auto; bord=
er-collapse: collapse; border-spacing: 0; box-sizing: border-box; margin: 0=
 auto; max-width: 640px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padd=
ing: 0; table-layout: auto; width: 100%;"><tbody><tr>
<td height=3D"40" s=
tyle=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collap=
se: collapse; box-sizing: border-box; font-size: 40px; height: 40px; hyphen=
s: auto; line-height: 40px; margin: 0; mso-table-lspace: 0pt; mso-table-rsp=
ace: 0pt; padding: 0; word-wrap: break-word;">=C2=A0</td>
               =
                                 </tr></tbody></table>
</td>
          =
                          </tr></tbody></table>
<!-- //SECTION TRANCHE 1 =
--><!-- SECTION TRANCHE 2 --><table align=3D"center" bgcolor=3D"#FFFFFF" bo=
rder=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"dmTableResponsive b=
g-blanc" role=3D"presentation" width=3D"100%" style=3D"Margin: 0 auto; back=
ground: #FFFFFF; border-collapse: collapse; border-spacing: 0; box-sizing: =
border-box; margin: 0 auto; max-width: 640px; min-width: 640px; mso-table-l=
space: 0pt; mso-table-rspace: 0pt; padding: 0; table-layout: fixed; width: =
640px;"><tbody>
<tr>
<td style=3D"-moz-hyphens: auto; -webkit-hyphens: =
auto; Margin: 0; border-collapse: collapse; box-sizing: border-box; hyphens=
: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0=
; word-wrap: break-word;">
                                            <t=
able align=3D"center" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" clas=
s=3D"dmTableResponsive" role=3D"presentation" width=3D"100%" style=3D"Margi=
n: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizing: border=
-box; margin: 0 auto; max-width: 640px; min-width: 640px; mso-table-lspace:=
 0pt; mso-table-rspace: 0pt; padding: 0; table-layout: auto; width: 640px;"=
><tbody><tr>
<td class=3D"w20" width=3D"20" style=3D"-moz-hyphens: auto; =
-webkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: bo=
rder-box; hyphens: auto; margin: 0; max-width: 20px; mso-table-lspace: 0pt;=
 mso-table-rspace: 0pt; padding: 0; width: 3.125%; word-wrap: break-word;">=
=C2=A0</td>
                                                    <td class=
=3D"text-left w600" valign=3D"top" width=3D"600" style=3D"-moz-hyphens: aut=
o; -webkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing:=
 border-box; hyphens: auto; margin: 0; max-width: 600px; mso-table-lspace: =
0pt; mso-table-rspace: 0pt; padding: 0; text-align: left; width: 93.75%; wo=
rd-wrap: break-word;">
                                                  =
      <table align=3D"center" border=3D"0" cellpadding=3D"0" cellspacing=3D=
"0" role=3D"presentation" style=3D"Margin: 0 auto; border-collapse: collaps=
e; border-spacing: 0; box-sizing: border-box; margin: 0 auto; mso-table-lsp=
ace: 0pt; mso-table-rspace: 0pt; table-layout: auto;"><tbody><tr>
<td ali=
gn=3D"center" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0=
; border-collapse: collapse; box-sizing: border-box; hyphens: auto; margin:=
 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: br=
eak-word;">
                                                             =
       <table align=3D"center" border=3D"0" cellpadding=3D"0" cellspacing=
=3D"0" role=3D"presentation" style=3D"Margin: 0 auto; border-collapse: coll=
apse; border-spacing: 0; box-sizing: border-box; margin: 0 auto; mso-table-=
lspace: 0pt; mso-table-rspace: 0pt; table-layout: auto;"><tbody>
<tr>
<=
td align=3D"center" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Mar=
gin: 0; border-collapse: collapse; box-sizing: border-box; hyphens: auto; m=
argin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; word-wr=
ap: break-word;"><a href=3D"http://mld.lameteonationale.com/c/23823255-4953=
320/f81a325d79177def5f64c4c508a20718/aHR0cHM6Ly9jbGsudHJhZGVkb3VibGVyLmNvbS=
9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDAmZz0yNTIzNDk1NCZ1cmw9aHR0cHM6Ly9jb2R0cmszL=
mZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaWVuPXYxJl9wZXJzbz0x" target=3D"_blank" styl=
e=3D"background: initial; color: #a8a8a8; mso-style-priority: 99; padding-r=
ight: initial; text-decoration: none;"><img class=3D"d600m300" role=3D"pres=
entation" src=3D"http://mld.lameteonationale.com/r/097cd91771427efba20fa9d6=
63015957/aHR0cHM6Ly9oc3QudHJhZGVkb3VibGVyLmNvbS9maWxlLzMyOTg5Ni9pbWFnZXMvc3=
BlYzAzLmdpZg" width=3D"600" style=3D"-ms-interpolation-mode: bicubic; borde=
r: 0; display: block; margin: 0 auto; max-width: 600px; outline: none; text=
-decoration: none; width: 100%;" alt=3D""></a></td>
                     =
                                                   </tr>
<tr>
<td heigh=
t=3D"15" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; bor=
der-collapse: collapse; box-sizing: border-box; font-size: 15px; height: 15=
px; hyphens: auto; line-height: 15px; margin: 0; mso-table-lspace: 0pt; mso=
-table-rspace: 0pt; padding: 0; word-wrap: break-word;">=C2=A0</td>
     =
                                                                   </tr>
=
<tr>
<td align=3D"center" valign=3D"top" style=3D"-moz-hyphens: auto; -we=
bkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: borde=
r-box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0=
pt; padding: 0; word-wrap: break-word;">
                                =
                                                <p class=3D"sous-titre text=
-091043" style=3D"-ms-hyphens: none; -webkit-hyphens: none; Margin: 0; colo=
r: #091043; font-size: 25px; font-weight: bold; hyphens: none; line-height:=
 1.2; margin: 0; padding: 0; text-transform: uppercase;"><a class=3D"text-0=
91043 text-underline-none" href=3D"http://mld.lameteonationale.com/c/238232=
55-4953320/f81a325d79177def5f64c4c508a20718/aHR0cHM6Ly9jbGsudHJhZGVkb3VibGV=
yLmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDAmZz0yNTIzNDk1NCZ1cmw9aHR0cHM6Ly9jb2=
R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaWVuPXYxJl9wZXJzbz0x" target=3D"_blan=
k" style=3D"background: initial; color: #091043; mso-style-priority: 99; pa=
dding-right: initial; text-decoration: none;"><span class=3D"text-091043 te=
xt-underline-none" style=3D"-ms-hyphens: none; -webkit-hyphens: none; Margi=
n: 0; color: #091043; hyphens: none; margin: 0; padding: 0; text-decoration=
: none;">une modularit=C3=A9 in=C3=A9gal=C3=A9e</span></a></p>
          =
                                                                  </td>
 =
                                                                       </tr=
>
</tbody></table>
</td>
                                            =
                </tr></tbody></table>
</td>
                           =
                         <td class=3D"w20" width=3D"20" style=3D"-moz-hyphe=
ns: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-=
sizing: border-box; hyphens: auto; margin: 0; max-width: 20px; mso-table-ls=
pace: 0pt; mso-table-rspace: 0pt; padding: 0; width: 3.125%; word-wrap: bre=
ak-word;">=C2=A0</td>
                                                </t=
r></tbody></table>
<table border=3D"0" cellpadding=3D"0" cellspacing=3D"0=
" class=3D"spacer" role=3D"presentation" width=3D"100%" style=3D"Margin: 0 =
auto; border-collapse: collapse; border-spacing: 0; box-sizing: border-box;=
 margin: 0 auto; max-width: 640px; mso-table-lspace: 0pt; mso-table-rspace:=
 0pt; padding: 0; table-layout: auto; width: 100%;"><tbody><tr>
<td heigh=
t=3D"50" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; bor=
der-collapse: collapse; box-sizing: border-box; font-size: 50px; height: 50=
px; hyphens: auto; line-height: 50px; margin: 0; mso-table-lspace: 0pt; mso=
-table-rspace: 0pt; padding: 0; word-wrap: break-word;">=C2=A0</td>
     =
                                           </tr></tbody></table>
</td>
=
                                    </tr>
<tr>
<td align=3D"center" sty=
le=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse=
: collapse; box-sizing: border-box; hyphens: auto; margin: 0; mso-table-lsp=
ace: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: break-word;">
   =
                                         <table align=3D"center" bgcolor=3D=
"#FFFFFF" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"dmTable=
Responsive bg-blanc" role=3D"presentation" width=3D"100%" style=3D"Margin: =
0 auto; background: #FFFFFF; border-collapse: collapse; border-spacing: 0; =
box-sizing: border-box; margin: 0 auto; max-width: 640px; min-width: 640px;=
 mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; table-layout: au=
to; width: 640px;"><tbody><tr>
<td align=3D"center" style=3D"-moz-hyphens=
: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-si=
zing: border-box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-tabl=
e-rspace: 0pt; padding: 0; word-wrap: break-word;">
                     =
                                   <table border=3D"0" cellpadding=3D"0" ce=
llspacing=3D"0" role=3D"presentation" style=3D"Margin: 0 auto; border-colla=
pse: collapse; border-spacing: 0; box-sizing: border-box; margin: 0 auto; m=
so-table-lspace: 0pt; mso-table-rspace: 0pt; table-layout: auto;"><tbody><t=
r>
<td align=3D"center" bgcolor=3D"#e64426" class=3D"mobile-button-invers=
e-orange" valign=3D"middle" style=3D"-moz-box-sizing: border-box; -moz-hyph=
ens: auto; -webkit-box-sizing: border-box; -webkit-hyphens: auto; Margin: 0=
; background-color: #e64426; border-collapse: collapse; box-sizing: border-=
box; color: #FFFFFF; display: inline-block; font-family: 'Ubuntu', Arial, s=
ans-serif; font-size: 20px; font-weight: 400; hyphens: auto; margin: 0; mso=
-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 13px 30px; vertical-ali=
gn: middle; width: auto; word-wrap: break-word;">
                       =
                                             <table border=3D"0" cellpaddin=
g=3D"0" cellspacing=3D"0" style=3D"Margin: 0 auto; border-collapse: collaps=
e; border-spacing: 0; box-sizing: border-box; margin: 0 auto; mso-table-lsp=
ace: 0pt; mso-table-rspace: 0pt; table-layout: auto; width: auto;"><tbody><=
tr>
<td align=3D"center" valign=3D"middle" style=3D"-moz-hyphens: auto; -=
webkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: bor=
der-box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspace:=
 0pt; padding: 0; word-wrap: break-word;"><a class=3D"text-blanc text-under=
line-none text-md-20 text-xs-16" href=3D"http://mld.lameteonationale.com/c/=
23823255-4953320/f81a325d79177def5f64c4c508a20718/aHR0cHM6Ly9jbGsudHJhZGVkb=
3VibGVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDAmZz0yNTIzNDk1NCZ1cmw9aHR0cHM6=
Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaWVuPXYxJl9wZXJzbz0x" target=3D=
"_blank" style=3D"background: initial; color: #FFFFFF; font-size: 20px; fon=
t-weight: normal; line-height: 24px; mso-style-priority: 99; padding-right:=
 initial; text-decoration: none;"><span class=3D"text-blanc text-underline-=
none" style=3D"-ms-hyphens: none; -webkit-hyphens: none; Margin: 0; color: =
#FFFFFF; hyphens: none; margin: 0; padding: 0; text-decoration: none;">ET B=
IEN PLUS ENCORE=C2=A0=C2=A0</span></a></td>
                             =
                                               <td align=3D"center" valign=
=3D"middle" width=3D"11" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto=
; Margin: 0; border-collapse: collapse; box-sizing: border-box; hyphens: au=
to; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; wo=
rd-wrap: break-word;"><a class=3D"text-right inline-block" href=3D"http://m=
ld.lameteonationale.com/c/23823255-4953320/f81a325d79177def5f64c4c508a20718=
/aHR0cHM6Ly9jbGsudHJhZGVkb3VibGVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDAmZz=
0yNTIzNDk1NCZ1cmw9aHR0cHM6Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaWVuP=
XYxJl9wZXJzbz0x" target=3D"_blank" style=3D"background: initial; color: #a8=
a8a8; display: inline-block !important; mso-style-priority: 99; padding-rig=
ht: initial; text-align: right; text-decoration: none;"><img height=3D"20" =
role=3D"presentation" src=3D"http://mld.lameteonationale.com/r/22deac440eff=
7ed5d4522a1a6f6007be/aHR0cHM6Ly9oc3QudHJhZGVkb3VibGVyLmNvbS9maWxlLzMyOTg5Ni=
9pbWFnZXMvY2hldnJvbi1jdGEucG5n" width=3D"11" style=3D"-ms-interpolation-mod=
e: bicubic; border: 0; display: block; outline: none; text-decoration: none=
;" alt=3D""></a></td>
                                                   =
                     </tr></tbody></table>
</td>
                      =
                                      </tr></tbody></table>
</td>
     =
                                           </tr></tbody></table>
<table b=
order=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"spacer" role=3D"pr=
esentation" width=3D"100%" style=3D"Margin: 0 auto; border-collapse: collap=
se; border-spacing: 0; box-sizing: border-box; margin: 0 auto; max-width: 6=
40px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; table-layou=
t: auto; width: 100%;"><tbody><tr>
<td height=3D"40" style=3D"-moz-hyphen=
s: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-s=
izing: border-box; font-size: 40px; height: 40px; hyphens: auto; line-heigh=
t: 40px; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: =
0; word-wrap: break-word;">=C2=A0</td>
                                  =
              </tr></tbody></table>
</td>
                             =
       </tr>
</tbody></table>
<!-- //SECTION TRANCHE 2 --><!-- SECTION =
IMG BOTTOM --><table align=3D"center" bgcolor=3D"#FFFFFF" border=3D"0" cell=
padding=3D"0" cellspacing=3D"0" class=3D"dmTableResponsive bg-blanc" role=
=3D"presentation" width=3D"100%" style=3D"Margin: 0 auto; background: #FFFF=
FF; border-collapse: collapse; border-spacing: 0; box-sizing: border-box; m=
argin: 0 auto; max-width: 640px; min-width: 640px; mso-table-lspace: 0pt; m=
so-table-rspace: 0pt; padding: 0; table-layout: fixed; width: 640px;"><tbod=
y><tr>
<td align=3D"center" style=3D"-moz-hyphens: auto; -webkit-hyphens:=
 auto; Margin: 0; border-collapse: collapse; box-sizing: border-box; hyphen=
s: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: =
0; word-wrap: break-word;">
                                            <=
table align=3D"center" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" cla=
ss=3D"dmTableResponsive" role=3D"presentation" width=3D"100%" style=3D"Marg=
in: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizing: borde=
r-box; margin: 0 auto; max-width: 640px; min-width: 640px; mso-table-lspace=
: 0pt; mso-table-rspace: 0pt; padding: 0; table-layout: auto; width: 640px;=
"><tbody><tr>
<td align=3D"center" style=3D"-moz-hyphens: auto; -webkit-h=
yphens: auto; Margin: 0; border-collapse: collapse; box-sizing: border-box;=
 hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; pa=
dding: 0; word-wrap: break-word;"><a href=3D"http://mld.lameteonationale.co=
m/c/23823255-4953320/f81a325d79177def5f64c4c508a20718/aHR0cHM6Ly9jbGsudHJhZ=
GVkb3VibGVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDAmZz0yNTIzNDk1NCZ1cmw9aHR0=
cHM6Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaWVuPXYxJl9wZXJzbz0x" targe=
t=3D"_blank" style=3D"background: initial; color: #a8a8a8; mso-style-priori=
ty: 99; padding-right: initial; text-decoration: none;"><img class=3D"d640m=
320" role=3D"presentation" src=3D"http://mld.lameteonationale.com/r/92d0c6b=
168994f14486dd1c442e7aa2b/aHR0cHM6Ly9oc3QudHJhZGVkb3VibGVyLmNvbS9maWxlLzMyO=
Tg5Ni9pbWFnZXMvaW1nLWJvdHRvbS5wbmc" width=3D"640" style=3D"-ms-interpolatio=
n-mode: bicubic; border: 0; display: block; margin: 0 auto; max-width: 640p=
x; outline: none; text-decoration: none; width: 100%;" alt=3D""></a></td>=

                                                </tr></tbody></table>
=
</td>
                                    </tr></tbody></table>
<!-- //=
SECTION IMG BOTTOM --><!-- FOOTER --><table align=3D"center" bgcolor=3D"#e6=
4426" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"dmTableResp=
onsive bg-091043" role=3D"presentation" width=3D"100%" style=3D"Margin: 0 a=
uto; background: #091043; border-collapse: collapse; border-spacing: 0; box=
-sizing: border-box; margin: 0 auto; max-width: 640px; min-width: 640px; ms=
o-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; table-layout: fixed=
; width: 640px;"><tbody><tr>
<td align=3D"center" valign=3D"top" style=3D=
"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: col=
lapse; box-sizing: border-box; hyphens: auto; margin: 0; mso-table-lspace: =
0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: break-word;">
        =
                                    <center>
                            =
                    <!--[if (gte mso 9)|(IE)]>
                          =
          <table width=3D"640" align=3D"center" cellpadding=3D"0" cellspaci=
ng=3D"0" style=3D"width:640px">
                                      <tr=
>
                                        <td>
                        =
                <![endif]-->
                                            =
    <table border=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"spacer=
" role=3D"presentation" width=3D"100%" style=3D"Margin: 0 auto; border-coll=
apse: collapse; border-spacing: 0; box-sizing: border-box; margin: 0 auto; =
max-width: 640px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0;=
 table-layout: auto; width: 100%;"><tbody><tr>
<td height=3D"30" style=3D=
"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: col=
lapse; box-sizing: border-box; font-size: 30px; height: 30px; hyphens: auto=
; line-height: 30px; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0p=
t; padding: 0; word-wrap: break-word;">=C2=A0</td>
                      =
                              </tr></tbody></table>
<!-- SECTION RESEAUX =
SOCIAUX --><table border=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D=
"dmTableResponsive" role=3D"presentation" width=3D"100%" style=3D"Margin: 0=
 auto; border-collapse: collapse; border-spacing: 0; box-sizing: border-box=
; margin: 0 auto; max-width: 640px; min-width: 640px; mso-table-lspace: 0pt=
; mso-table-rspace: 0pt; padding: 0; table-layout: auto; width: 640px;"><tb=
ody><tr>
<td align=3D"center" valign=3D"top" style=3D"-moz-hyphens: auto;=
 -webkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: b=
order-box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspac=
e: 0pt; padding: 0; word-wrap: break-word;">
                            =
                                <table border=3D"0" cellpadding=3D"0" cells=
pacing=3D"0" width=3D"100%" style=3D"Margin: 0 auto; border-collapse: colla=
pse; border-spacing: 0; box-sizing: border-box; margin: 0 auto; mso-table-l=
space: 0pt; mso-table-rspace: 0pt; table-layout: auto;"><tbody><tr>
<td c=
lass=3D"colon-md-10 colon-xs-10" style=3D"-moz-hyphens: auto; -webkit-hyphe=
ns: auto; Margin: 0; border-collapse: collapse; box-sizing: border-box; hyp=
hens: auto; margin: 0; min-width: 10%; mso-table-lspace: 0pt; mso-table-rsp=
ace: 0pt; padding: 0; width: 10%; word-wrap: break-word;">=C2=A0</td>
   =
                                                                 <td align=
=3D"center" class=3D"colon-md-80 colon-xs-80" valign=3D"middle" style=3D"-m=
oz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: collap=
se; box-sizing: border-box; hyphens: auto; margin: 0; min-width: 80%; mso-t=
able-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; width: 80%; word-wrap:=
 break-word;">
                                                          =
              <table border=3D"0" cellpadding=3D"0" cellspacing=3D"0" role=
=3D"presentation" width=3D"100%" style=3D"Margin: 0 auto; border-collapse: =
collapse; border-spacing: 0; box-sizing: border-box; margin: 0 auto; mso-ta=
ble-lspace: 0pt; mso-table-rspace: 0pt; table-layout: auto;"><tbody><tr>
=
<td align=3D"center" class=3D"text-center plr5mob" style=3D"-moz-hyphens: a=
uto; -webkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizin=
g: border-box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-r=
space: 0pt; padding: 0; text-align: center; word-wrap: break-word;"><a href=
=3D"http://mld.lameteonationale.com/c/23823255-4953320/f81a325d79177def5f64=
c4c508a20718/aHR0cHM6Ly9jbGsudHJhZGVkb3VibGVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPT=
IyNzM1NDAmZz0yNTIzNDk1NCZ1cmw9aHR0cHM6Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5M=
y8lM0ZsaWVuPXYxJl9wZXJzbz0x" target=3D"_blank" style=3D"background: initial=
; color: #a8a8a8; mso-style-priority: 99; padding-right: initial; text-deco=
ration: none;"><img alt=3D"linkedin" class=3D"d41" src=3D"http://mld.lamete=
onationale.com/r/12c77457dc4bf3331fd4e01c980a0864/aHR0cHM6Ly9oc3QudHJhZGVkb=
3VibGVyLmNvbS9maWxlLzMyOTg5Ni9pbWFnZXMvbGlua2VkaW4ucG5n" width=3D"41" style=
=3D"-ms-interpolation-mode: bicubic; border: 0; display: block; margin: 0 a=
uto; max-width: 41px; outline: none; text-decoration: none; width: 41px;"><=
/a></td>
                                                                =
                <td align=3D"center" class=3D"text-center plr5mob" style=3D=
"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: col=
lapse; box-sizing: border-box; hyphens: auto; margin: 0; mso-table-lspace: =
0pt; mso-table-rspace: 0pt; padding: 0; text-align: center; word-wrap: brea=
k-word;"><a href=3D"http://mld.lameteonationale.com/c/23823255-4953320/f81a=
325d79177def5f64c4c508a20718/aHR0cHM6Ly9jbGsudHJhZGVkb3VibGVyLmNvbS9jbGljaz=
9wPTMyOTg5NiZhPTIyNzM1NDAmZz0yNTIzNDk1NCZ1cmw9aHR0cHM6Ly9jb2R0cmszLmZyL2xfV=
0VCX1dFQl8zMzQ5My8lM0ZsaWVuPXYxJl9wZXJzbz0x" target=3D"_blank" style=3D"bac=
kground: initial; color: #a8a8a8; mso-style-priority: 99; padding-right: in=
itial; text-decoration: none;"><img alt=3D"Twitter" class=3D"d41" src=3D"ht=
tp://mld.lameteonationale.com/r/41e45a65cbeb2eedcc2b226a1e92dfc8/aHR0cHM6Ly=
9oc3QudHJhZGVkb3VibGVyLmNvbS9maWxlLzMyOTg5Ni9pbWFnZXMvdHdpdHRlci5wbmc" widt=
h=3D"41" style=3D"-ms-interpolation-mode: bicubic; border: 0; display: bloc=
k; margin: 0 auto; max-width: 41px; outline: none; text-decoration: none; w=
idth: 41px;"></a></td>
                                                  =
                              <td align=3D"center" class=3D"text-center plr=
5mob" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border=
-collapse: collapse; box-sizing: border-box; hyphens: auto; margin: 0; mso-=
table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; text-align: center; w=
ord-wrap: break-word;"><a href=3D"http://mld.lameteonationale.com/c/2382325=
5-4953320/f81a325d79177def5f64c4c508a20718/aHR0cHM6Ly9jbGsudHJhZGVkb3VibGVy=
LmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDAmZz0yNTIzNDk1NCZ1cmw9aHR0cHM6Ly9jb2R=
0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaWVuPXYxJl9wZXJzbz0x" target=3D"_blank=
" style=3D"background: initial; color: #a8a8a8; mso-style-priority: 99; pad=
ding-right: initial; text-decoration: none;"><img alt=3D"Facebook" class=3D=
"d41" src=3D"http://mld.lameteonationale.com/r/5eda7a4824eacc39acaefc8870ad=
eaf6/aHR0cHM6Ly9oc3QudHJhZGVkb3VibGVyLmNvbS9maWxlLzMyOTg5Ni9pbWFnZXMvZmFjZW=
Jvb2sucG5n" width=3D"41" style=3D"-ms-interpolation-mode: bicubic; border: =
0; display: block; margin: 0 auto; max-width: 41px; outline: none; text-dec=
oration: none; width: 41px;"></a></td>
                                  =
                                              <td align=3D"center" class=3D=
"text-center plr5mob" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; M=
argin: 0; border-collapse: collapse; box-sizing: border-box; hyphens: auto;=
 margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; text-=
align: center; word-wrap: break-word;"><a href=3D"http://mld.lameteonationa=
le.com/c/23823255-4953320/f81a325d79177def5f64c4c508a20718/aHR0cHM6Ly9jbGsu=
dHJhZGVkb3VibGVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDAmZz0yNTIzNDk1NCZ1cmw=
9aHR0cHM6Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaWVuPXYxJl9wZXJzbz0x" =
target=3D"_blank" style=3D"background: initial; color: #a8a8a8; mso-style-p=
riority: 99; padding-right: initial; text-decoration: none;"><img alt=3D"In=
stagram" class=3D"d41" src=3D"http://mld.lameteonationale.com/r/de78f31ce58=
cd62d76684ee772975941/aHR0cHM6Ly9oc3QudHJhZGVkb3VibGVyLmNvbS9maWxlLzMyOTg5N=
i9pbWFnZXMvaW5zdGFncmFtLnBuZw" width=3D"41" style=3D"-ms-interpolation-mode=
: bicubic; border: 0; display: block; margin: 0 auto; max-width: 41px; outl=
ine: none; text-decoration: none; width: 41px;"></a></td>
               =
                                                                 <td align=
=3D"center" class=3D"text-center plr5mob" style=3D"-moz-hyphens: auto; -web=
kit-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: border=
-box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0p=
t; padding: 0; text-align: center; word-wrap: break-word;"><a href=3D"http:=
//mld.lameteonationale.com/c/23823255-4953320/f81a325d79177def5f64c4c508a20=
718/aHR0cHM6Ly9jbGsudHJhZGVkb3VibGVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDA=
mZz0yNTIzNDk1NCZ1cmw9aHR0cHM6Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaW=
VuPXYxJl9wZXJzbz0x" target=3D"_blank" style=3D"background: initial; color: =
#a8a8a8; mso-style-priority: 99; padding-right: initial; text-decoration: n=
one;"><img alt=3D"Youtube" class=3D"d41" src=3D"http://mld.lameteonationale=
.com/r/4a30ca48686c93f31087191f887863b1/aHR0cHM6Ly9oc3QudHJhZGVkb3VibGVyLmN=
vbS9maWxlLzMyOTg5Ni9pbWFnZXMveW91dHViZS5wbmc" width=3D"41" style=3D"-ms-int=
erpolation-mode: bicubic; border: 0; display: block; margin: 0 auto; max-wi=
dth: 41px; outline: none; text-decoration: none; width: 41px;"></a></td>
=
                                                                           =
 </tr></tbody></table>
</td>
                                          =
                          <td class=3D"colon-md-10 colon-xs-10" style=3D"-m=
oz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: collap=
se; box-sizing: border-box; hyphens: auto; margin: 0; min-width: 10%; mso-t=
able-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; width: 10%; word-wrap:=
 break-word;">=C2=A0</td>
                                               =
                 </tr></tbody></table>
</td>
                          =
                          </tr></tbody></table>
<!-- //SECTION RESEAUX SO=
CIAUX --><table border=3D"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"s=
pacer" role=3D"presentation" width=3D"100%" style=3D"Margin: 0 auto; border=
-collapse: collapse; border-spacing: 0; box-sizing: border-box; margin: 0 a=
uto; max-width: 640px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; paddin=
g: 0; table-layout: auto; width: 100%;"><tbody><tr>
<td height=3D"30" sty=
le=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse=
: collapse; box-sizing: border-box; font-size: 30px; height: 30px; hyphens:=
 auto; line-height: 30px; margin: 0; mso-table-lspace: 0pt; mso-table-rspac=
e: 0pt; padding: 0; word-wrap: break-word;">=C2=A0</td>
                 =
                                   </tr></tbody></table>
<table border=3D=
"0" cellpadding=3D"0" cellspacing=3D"0" class=3D"spacer" role=3D"presentati=
on" width=3D"100%" style=3D"Margin: 0 auto; border-collapse: collapse; bord=
er-spacing: 0; box-sizing: border-box; margin: 0 auto; max-width: 640px; ms=
o-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; table-layout: auto;=
 width: 100%;"><tbody><tr>
<td align=3D"center" valign=3D"top" style=3D"-=
moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: colla=
pse; box-sizing: border-box; hyphens: auto; margin: 0; mso-table-lspace: 0p=
t; mso-table-rspace: 0pt; padding: 0; word-wrap: break-word;">
          =
                                                  <table border=3D"0" cellp=
adding=3D"0" cellspacing=3D"0" width=3D"100%" style=3D"Margin: 0 auto; bord=
er-collapse: collapse; border-spacing: 0; box-sizing: border-box; margin: 0=
 auto; mso-table-lspace: 0pt; mso-table-rspace: 0pt; table-layout: auto;"><=
tbody><tr>
<td class=3D"colon-md-30 colon-xs-hidden" height=3D"2" style=
=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: =
collapse; box-sizing: border-box; font-size: 1px; height: 1px; hyphens: aut=
o; line-height: 1px; margin: 0; min-width: 20%; mso-table-lspace: 0pt; mso-=
table-rspace: 0pt; padding: 0; width: 20%; word-wrap: break-word;">=C2=
=A0</td>
                                                                =
    <td bgcolor=3D"#FFFFFF" class=3D"colon-md-40 bg-blanc-footer" height=3D=
"2" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-c=
ollapse: collapse; box-sizing: border-box; font-size: 1px; height: 1px; hyp=
hens: auto; line-height: 1px; margin: 0; min-width: 40%; mso-table-lspace: =
0pt; mso-table-rspace: 0pt; opacity: 0.25; padding: 0; width: 40%; word-wra=
p: break-word;">=C2=A0</td>
                                             =
                       <td class=3D"colon-md-30 colon-xs-hidden" height=3D"=
2" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-co=
llapse: collapse; box-sizing: border-box; font-size: 1px; height: 1px; hyph=
ens: auto; line-height: 1px; margin: 0; min-width: 20%; mso-table-lspace: 0=
pt; mso-table-rspace: 0pt; padding: 0; width: 20%; word-wrap: break-word;">=
=C2=A0</td>
                                                             =
   </tr></tbody></table>
</td>
                                        =
            </tr></tbody></table>
<table border=3D"0" cellpadding=3D"0" c=
ellspacing=3D"0" class=3D"spacer" role=3D"presentation" width=3D"100%" styl=
e=3D"Margin: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizi=
ng: border-box; margin: 0 auto; max-width: 640px; mso-table-lspace: 0pt; ms=
o-table-rspace: 0pt; padding: 0; table-layout: auto; width: 100%;"><tbody><=
tr>
<td height=3D"30" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto;=
 Margin: 0; border-collapse: collapse; box-sizing: border-box; font-size: 3=
0px; height: 30px; hyphens: auto; line-height: 30px; margin: 0; mso-table-l=
space: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: break-word;">=
=C2=A0</td>
                                                    </tr></tb=
ody></table>
<table border=3D"0" cellpadding=3D"0" cellspacing=3D"0" clas=
s=3D"dmTableResponsive" role=3D"presentation" width=3D"100%" style=3D"Margi=
n: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizing: border=
-box; margin: 0 auto; max-width: 640px; min-width: 640px; mso-table-lspace:=
 0pt; mso-table-rspace: 0pt; padding: 0; table-layout: auto; width: 640px;"=
><tbody><tr>
<td align=3D"center" valign=3D"top" style=3D"-moz-hyphens: a=
uto; -webkit-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizin=
g: border-box; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-r=
space: 0pt; padding: 0; word-wrap: break-word;"><a href=3D"http://mld.lamet=
eonationale.com/c/23823255-4953320/f81a325d79177def5f64c4c508a20718/aHR0cHM=
6Ly9jbGsudHJhZGVkb3VibGVyLmNvbS9jbGljaz9wPTMyOTg5NiZhPTIyNzM1NDAmZz0yNTIzND=
k1NCZ1cmw9aHR0cHM6Ly9jb2R0cmszLmZyL2xfV0VCX1dFQl8zMzQ5My8lM0ZsaWVuPXYxJl9wZ=
XJzbz0x" target=3D"_blank" style=3D"background: initial; color: #a8a8a8; ms=
o-style-priority: 99; padding-right: initial; text-decoration: none;"><img =
role=3D"presentation" src=3D"http://mld.lameteonationale.com/r/2481aa59be4a=
87b7ca295b9e1bf4a6c7/aHR0cHM6Ly9oc3QudHJhZGVkb3VibGVyLmNvbS9maWxlLzMyOTg5Ni=
9pbWFnZXMvbG9nby1ib3R0b20ucG5n" width=3D"104" style=3D"-ms-interpolation-mo=
de: bicubic; border: 0; display: block; outline: none; text-decoration: non=
e;" alt=3D""></a></td>
                                                  =
  </tr></tbody></table>
<table border=3D"0" cellpadding=3D"0" cellspacing=
=3D"0" class=3D"spacer" role=3D"presentation" width=3D"100%" style=3D"Margi=
n: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizing: border=
-box; margin: 0 auto; max-width: 640px; mso-table-lspace: 0pt; mso-table-rs=
pace: 0pt; padding: 0; table-layout: auto; width: 100%;"><tbody><tr>
<td =
height=3D"30" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0=
; border-collapse: collapse; box-sizing: border-box; font-size: 30px; heigh=
t: 30px; hyphens: auto; line-height: 30px; margin: 0; mso-table-lspace: 0pt=
; mso-table-rspace: 0pt; padding: 0; word-wrap: break-word;">=C2=A0</td>
=
                                                    </tr></tbody></table>=

<!-- SECTION ML --><table border=3D"0" cellpadding=3D"0" cellspacing=3D"=
0" class=3D"dmTableResponsive" role=3D"presentation" width=3D"100%" style=
=3D"Margin: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizin=
g: border-box; margin: 0 auto; max-width: 640px; min-width: 640px; mso-tabl=
e-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; table-layout: auto; width=
: 640px;"><tbody><tr>
<td class=3D"showDesktopHideMobile w50" width=3D"50=
" style=3D"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-col=
lapse: collapse; box-sizing: border-box; display: block; hyphens: auto; mar=
gin: 0; max-width: 50px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padd=
ing: 0; width: 50px; word-wrap: break-word;">=C2=A0</td>
                =
                                        <td align=3D"left" class=3D"padding=
LeftRight5 colon-xs-100" width=3D"500" style=3D"-moz-hyphens: auto; -webkit=
-hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: border-bo=
x; hyphens: auto; margin: 0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; =
padding: 0; padding-left: 5px; padding-right: 5px; word-wrap: break-word;">=

                                                            <p class=3D"=
text-md-12 text-left text-blanc" style=3D"-ms-hyphens: none; -webkit-hyphen=
s: none; Margin: 0; color: #FFFFFF; font-size: 12px; font-weight: normal; h=
yphens: none; line-height: 16px; margin: 0; padding: 0; text-align: left;">=
<span class=3D"text-blanc text-underline-none" style=3D"-ms-hyphens: none; =
-webkit-hyphens: none; Margin: 0; color: #FFFFFF; hyphens: none; margin: 0;=
 padding: 0; text-decoration: none;">CONSOMMATIONS MIXTES DE NOUVEAU CITRO=
=C3=8BN C5 AIRCROSS : WLTP DE 1,4 =C3=80 6,7 L/100 KM.
<br><br>
       =
                                                             Automobiles Ci=
tro=C3=ABn est une soci=C3=A9t=C3=A9 par actions simplifi=C3=A9e au capital=
 de 159 000 000 euros dont le si=C3=A8ge social est situ=C3=A9 au 2-10 Boul=
evard de l'Europe - 78300 POISSY, RCS VERSAILLES 642 050 199. Ce message a =
=C3=A9t=C3=A9 adress=C3=A9 =C3=A0 l'aide des informations du fichier d=
=E2=80=99Automobiles Citro=C3=ABn. Conform=C3=A9ment au R=C3=A8glement G=
=C3=A9n=C3=A9ral sur la Protection des Donn=C3=A9es n=C2=B0 2016/679 du 27 =
avril 2016 et =C3=A0 la Loi Informatique et Libert=C3=A9s n=C2=B078-17 du 6=
 janvier 1978, vous disposez d'un droit d'acc=C3=A8s, de rectification, d'e=
ffacement, de limitation du traitement, d'obtention d'une copie de vos donn=
=C3=A9es =C3=A0 caract=C3=A8re personnel pour vos propres besoins ou pour l=
es transmettre =C3=A0 un autre prestataire de services de votre choix (port=
abilit=C3=A9), ainsi que d'un droit d'opposition au traitement de vos donn=
=C3=A9es =C3=A0 caract=C3=A8re personnel lorsque ces donn=C3=A9es sont trai=
t=C3=A9es =C3=A0 des fins de marketing direct ou lorsque le traitement est =
fond=C3=A9 sur l'int=C3=A9r=C3=AAt l=C3=A9gitime. Vous pouvez donc exercer =
ces droits en vous adressant par courrier =C3=A0 Automobiles Citro=C3=ABn =
=E2=80=93 Service Relations Client=C3=A8le =E2=80=93 Case YT227 =E2=80=
=93 2-10, boulevard de l=E2=80=99Europe =E2=80=93 78092 POISSY CEDEX 9 ou e=
n cliquant ici (rubrique Gestion des donn=C3=A9es personnelles). Si vous so=
uhaitez nous contacter, veuillez-vous rendre sur la rubrique "Contactez-nou=
s" sur notre site.=20

=20
 </span></p>
                               =
                         </td>
                                          =
              <td class=3D"showDesktopHideMobile w50" width=3D"50" style=3D=
"-moz-hyphens: auto; -webkit-hyphens: auto; Margin: 0; border-collapse: col=
lapse; box-sizing: border-box; display: block; hyphens: auto; margin: 0; ma=
x-width: 50px; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; wi=
dth: 50px; word-wrap: break-word;">=C2=A0</td>
                          =
                          </tr></tbody></table>
<table border=3D"0" cellp=
adding=3D"0" cellspacing=3D"0" class=3D"spacer" role=3D"presentation" width=
=3D"100%" style=3D"Margin: 0 auto; border-collapse: collapse; border-spacin=
g: 0; box-sizing: border-box; margin: 0 auto; max-width: 640px; mso-table-l=
space: 0pt; mso-table-rspace: 0pt; padding: 0; table-layout: auto; width: 1=
00%;"><tbody><tr>
<td height=3D"20" style=3D"-moz-hyphens: auto; -webkit-=
hyphens: auto; Margin: 0; border-collapse: collapse; box-sizing: border-box=
; font-size: 20px; height: 20px; hyphens: auto; line-height: 20px; margin: =
0; mso-table-lspace: 0pt; mso-table-rspace: 0pt; padding: 0; word-wrap: bre=
ak-word;">=C2=A0</td>
                                                   =
 </tr></tbody></table>
<!-- //SECTION ML --><!--[if (gte mso 9)|(IE)]>
=
                                  </td>
                                <=
/tr>
                              </table>
                          <=
![endif]-->
</center>
                                        </td>
 =
                                   </tr></tbody></table>
<!-- //FOOTER --=
>
</center>
                        </td>
                    </tr></=
tbody></table>
<!--[if (gte mso 9)|(IE)]>
                      </td>=

                    </tr>
                  </table>
              <=
![endif]-->
</center>
        </div>
        <!-- PREVENT GMAIL ON iO=
S FONT-SIZE MANIPULATION -->
        <div style=3D"display:none;white-spa=
ce:nowrap;font:12px courier;line-height:0;">
            =C2=A0 =C2=A0 =
=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =
=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =
=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0
        </div>
=
<!-- // PREVENT GMAIL ON iOS FONT-SIZE MANIPULATION -->
=09=09<img src=3D=
"http://mld.lameteonationale.com/r/187d3a7f54cdbe651a5bc6afd58cfbec/aHR0cHM=
6Ly9jb2R0cmszLmZyL2lfV0VCX1dFQl8zMzQ5My8" alt=3D"" height=3D"1" width=3D"1"=
>
</td>
               </tr></tbody></table>
</td>
                =
</tr></table>
</td>
            </tr>
<tr>
<td style=3D"padding-top=
: 30px;" class=3D"weather">
                <table width=3D"100%" border=
=3D"0" cellpadding=3D"0" cellspacing=3D"0" align=3D"center" style=3D"border=
-collapse: collapse;">
<tr>
<td>
            <table width=3D"100%" bo=
rder=3D"0" cellpadding=3D"0" cellspacing=3D"0" align=3D"center" style=3D"bo=
rder-collapse: collapse;"><tr>
<td style=3D"font-size: 20px;line-height: =
22px;color: #ffffff; padding: 0 0 0 20px; background-color: #489ee9;" align=
=3D"left">Les pr=C3=A9visions en France :</td>
                    <td al=
ign=3D"left" style=3D"border-collapse: collapse;" width=3D"83">
         =
               <img src=3D"http://mld.lameteonationale.com/r/509850e155a7a0=
191a22749b088ef7f1/aHR0cDovL3N0YXRpYzIub3B0aW5jb2xsZWN0Lm5ldC9tYWlsaW5nL3dl=
YXRoZXIvY29tbW9uL3ByZXZpc2lvbi5naWY" alt=3D"" width=3D"83" height=3D"37" st=
yle=3D"display: block;" class=3D"image_fix">
</td>
                    =
<td align=3D"right" width=3D"220">
                        <table width=
=3D"220" border=3D"0" cellpadding=3D"0" cellspacing=3D"0" align=3D"center" =
style=3D"border-collapse: collapse;">
<tr><td height=3D"30" style=3D"line=
-height: 30px;">=C2=A0</td></tr>
<tr><td height=3D"7" style=3D"line-heigh=
t: 7px; background-color: #489ee9;">=C2=A0</td></tr>
</table>
</td>
 =
               </tr></table>
</td>
    </tr>
<tr>
<td style=3D"padd=
ing: 10px 0;">
            <table width=3D"100%" border=3D"0" cellpadding=
=3D"0" cellspacing=3D"0" align=3D"center" style=3D"border-collapse: collaps=
e;font-size: 15px;line-height: 17px;color: #5a5a5a;"><tr>
<td width=3D"50=
%" colspan=3D"4" style=3D"border-right: 1px solid #e1e3ea; vertical-align: =
top;">
                        <table width=3D"100%" border=3D"0" cellpad=
ding=3D"0" cellspacing=3D"0" align=3D"center" style=3D"border-collapse: col=
lapse;"><tr>
<td style=3D"padding: 5px 10px;font-size: 12px;line-height: =
14px;font-style: italic;color: #a4a4a4;border-right: 1px solid #e1e3ea;" al=
ign=3D"right" colspan=3D"3">Min.</td>
                                <td=
 style=3D"padding: 5px 10px;font-size: 12px;line-height: 14px;font-style: i=
talic;color: #a4a4a4;" align=3D"right">Max.</td>
                        =
    </tr></table>
</td>
                </tr></table>
</td>
    </t=
r>
</table>
</td>
            </tr>
</table>
</td>
      </tr>=

<tr>
<td align=3D"center" height=3D"30">
<br><span style=3D"font-siz=
e: 11px; display: block; color: #666666; font-family: Verdana,Arial,Helveti=
ca,sans-serif;">
                Pour ne plus recevoir de newsletter, <a =
href=3D"http://mld.lameteonationale.com/unsubscribe?cid=3D4953320&amp;email=
=3Dmarc.malroux%40orange.fr" target=3D"_blank" rel=3D"notracking" data-type=
=3D"tpl">d=C3=A9sabonnez-vous</a>
                <br><br>
            =
    Vous recevez ce message publicitaire car vous =C3=AAtes inscrit =C3=
=A0 la newsletter La M=C3=A9t=C3=A9o Nationale.
                <br><br>=

                Conform=C3=A9ment =C3=A0 la loi Informatique et Libert=
=C3=A9 et au RGPD, vous disposez notamment d'un
                <br>
  =
              droit d'acc=C3=A8s,=C2=A0de rectification et d'opposition aux=
 donn=C3=A9es vous concernant.=C2=A0
                <br><br><a href=3D"h=
ttp://mld.lameteonationale.com/r/721b1e3d8d3524ac4fcbd05a965b9714/aHR0cDovL=
21sZC5sYW1ldGVvbmF0aW9uYWxlLmNvbS8jbGVnYWxz" target=3D"_blank">Mentions l=
=C3=A9gales</a> | <a href=3D"http://mld.lameteonationale.com/r/aa610eeafc02=
87aa53a38fcff989c7d4/aHR0cDovL21sZC5sYW1ldGVvbmF0aW9uYWxlLmNvbS8jcHJpdmFjeQ=
" target=3D"_blank">Politique de confidentialit=C3=A9</a>
            </s=
pan>
        </td>
      </tr>
</table>
<!--[PIXEL]--><img id=3D"tr=
ackingPixel" src=3D"#" height=3D"1px" width=3D"1px"><img src=3D"http://mld.=
lameteonationale.com/r/9d82da222ddfcf76395d4160da52f2d3/aHR0cHM6Ly9weC5tb21=
lbnR1bWFwaS5jb20vYWN0aXZpdGllcz90b2tlbj03NWEyMWZjODEyZjZhYmY0NWY5OThmNTEzOT=
E3ZGRiMyZ0eXBlPW9wZW5pbmcmaWRlbnRpZmllcnNbMF1baWRlbnRpZmllclR5cGVdPWVtYWlsJ=
mlkZW50aWZpZXJzWzBdW2hhc2hdPWQ1ZThiMTZlN2U2OTA5ODIzMWY0MjMzMDQ0NjMxMTYyJmlk=
ZW50aWZpZXJzWzBdW2hhc2hUeXBlXT1tZDUmaWRlbnRpZmllcnNbMV1baWRlbnRpZmllclR5cGV=
dPWVtYWlsJmlkZW50aWZpZXJzWzFdW2hhc2hdPTZmN2I2OGVjYzJhN2I1OGYzNTFlZjIzYmNjZD=
c0NTQ2ZDkxYjdlOGY3ODIwODBmZGQ1YjdhZjk4MjQ2MDVmMjUmaWRlbnRpZmllcnNbMV1baGFza=
FR5cGVdPXNoYTI1Ng" alt=3D"" height=3D"1" width=3D"1"><img src=3D"http://mld=
.lameteonationale.com/o/23823255-4953320/f81a325d79177def5f64c4c508a20718" =
height=3D"1" width=3D"1" alt=3D"">
</body>
</html>


--_=_swift_1654803092_e482b771a6467d5bba5ede5cd7679029_=_--

{PæAä      iéâ¢iéâ¢IjÐ¹ÿÿÿÿ   a    ~49f85b7a,:imap://marc.malroux%40orange.fr@imap.orange.fr:993/fetch%3EUID%3E/INBOX/TRASH%3E233639 security-info FnhllAKWRHGAlo+ESXykKAAAAAAAAAAAwAAAAAAAAEaphjojH6pBabDSgSnsfLHeAAAAAgAAAAAAAAAAAAAAAAAAAAEAOQFmCjImkVxP+7sgiYWmMt8FvcOXmlQiTNWFiWlrbpbqgwAAAAAAAAczMIIHLzCCBhegAwIBAgIQBclsKZMO8zxOPkkVwanUCzANBgkqhkiG9w0BAQsFADBZMQswCQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMTMwMQYDVQQDEypEaWdpQ2VydCBHbG9iYWwgRzIgVExTIFJTQSBTSEEyNTYgMjAyMCBDQTEwHhcNMjUwOTEzMDAwMDAwWhcNMjYwOTE1MjM1OTU5WjBYMQswCQYDVQQGEwJGUjEcMBoGA1UEBxMTSVNTWSBMRVMgTU9VTElORUFVWDESMBAGA1UEChMJT3JhbmdlIFNBMRcwFQYDVQQDEw5pbWFwLm9yYW5nZS5mcjCCASIwDQYJKoZIhvcNAQEBBQADggEPADCCAQoCggEBANNuk+RG9+cacpZd+/r1NuDEMsruxHcqH8DIfeEHXTJiisMyJXgeHPgKI4rc3+mv1bhDUAa5ai09LYFgfimd+1Ua2q7E/0jD0u9vm6eo3Jtyna2zPr8xNs7MxFBKBjpaJEUsdfBrtV3CCRnotL1MYO5kUMD+z6UubQ+adXkqRGSFg7EeOmgxtFGgiwV4im78EnxHN2XVSaw8pFRvtquC2hUIZEgrt7vdYYmKsrwHv0fhDFbD1ss9/fD4qQUNmm8bzMWOnV31utNgPlN1WeFWU2fXxUSKP9HPwQZoNXVhiH/LOi3YHHtte5L0fQuo6jvrtqfI2tbSndrjEZboYhKh4IcCAwEAAaOCA/IwggPuMB8GA1UdIwQYMBaAFHSFgMBmx9833s+9KTeqAx2+7c0XMB0GA1UdDgQWBBQrJSpubphCzigM0LK45MCCwb9UOzCBgwYDVR0RBHwweoIOaW1hcC5vcmFuZ2UuZnKCD2ltYXA0Lm9yYW5nZS5mcoIPaW1hcC53YW5hZG9vLmZygg1wb3Aub3JhbmdlLmZygg5wb3Aud2FuYWRvby5mcoIOcG9wMy5vcmFuZ2UuZnKCF3BvcC5tYWlsc2FudGUub3JhbmdlLmZyMD4GA1UdIAQ3MDUwMwYGZ4EMAQICMCkwJwYIKwYBBQUHAgEWG2h0dHA6Ly93d3cuZGlnaWNlcnQuY29tL0NQUzAOBgNVHQ8BAf8EBAMCBaAwHQYDVR0lBBYwFAYIKwYBBQUHAwEGCCsGAQUFBwMCMIGfBgNVHR8EgZcwgZQwSKBGoESGQmh0dHA6Ly9jcmwzLmRpZ2ljZXJ0LmNvbS9EaWdpQ2VydEdsb2JhbEcyVExTUlNBU0hBMjU2MjAyMENBMS0xLmNybDBIoEagRIZCaHR0cDovL2NybDQuZGlnaWNlcnQuY29tL0RpZ2lDZXJ0R2xvYmFsRzJUTFNSU0FTSEEyNTYyMDIwQ0ExLTEuY3JsMIGHBggrBgEFBQcBAQR7MHkwJAYIKwYBBQUHMAGGGGh0dHA6Ly9vY3NwLmRpZ2ljZXJ0LmNvbTBRBggrBgEFBQcwAoZFaHR0cDovL2NhY2VydHMuZGlnaWNlcnQuY29tL0RpZ2lDZXJ0R2xvYmFsRzJUTFNSU0FTSEEyNTYyMDIwQ0ExLTEuY3J0MAwGA1UdEwEB/wQCMAAwggF7BgorBgEEAdZ5AgQCBIIBawSCAWcBZQB1ANgJVTuUT3r/yBYZb5RPhauw+Pxeh1UmDxXRLnK7RUsUAAABmUNwVGYAAAQDAEYwRAIgLyIiiEn+3O0wurWsrU9OnZ0LZiN8AwXd94b8VjEhMeYCIFmPYd5L8xzFwapyvpeBzOG0VZeiabDLGkb4S+SAM2n9AHUAwjF+V0UZo0XufzjespBB68fCIVoiv3/Vta12mtkOUs0AAAGZQ3BUaAAABAMARjBEAiBm2ZlIATBlLlx/6QvZJ3cIHUJQMpUyQs7VcTOwu87rvwIgVdU4d97bZf/YFZAAp4iV4vomjWnEbYCD3KQNHnRHr6EAdQCUTkOH+uzB74HzGSQmqBhlAcfTXzgCAT9yZ31VNy4Z2AAAAZlDcFSAAAAEAwBGMEQCIB6LrXlAfOAPWkZFTkepLl4EEyvKm4pmpEQDVDCpblx+AiB02/ymEJIdmf44WnLwUHCT+CaP95eo3SUAXaOR77vtODANBgkqhkiG9w0BAQsFAAOCAQEAuC7Hw6ujCk1dlLvBtWGwGb9u7Ig4zPtHp6swoqe9UCL1/IkJhg/zjWodELc2/qVPZ6FD/ck+y/0JrTJYp0OOj4W5P/PyLsD1lhEO9dninVjgmrBgyzrSIKChQQfADOtOJPJOt2ltSKD3sRygzpEkX+EcMXNPIG4LY+KVtQX45/98SUZCJs/gP+QZ04/xeFqIwvjITdnXI4l+hTE1VAoyMcaUYPbTdSiKERrEBjR1z1HTVBDrtKNBzButfU12mBIP0/dQJux6MhQPu1QP9jcjKG72ITUpB4uZIUb2UWQj3hjH3XLfHT2YP8LQA7lpmkAOdZUdVZCWx8AY8p2BwydAGBMBAAQAAAAAAAEBAAAFAAAABFAyNTYAAAAOUlNBLVBTUy1TSEEyNTYAA2YKMiaRXE/7uyCJhaYy3wW9w5eaVCJM1YWJaWtuluqDAAAAAAAABzMwggcvMIIGF6ADAgECAhAFyWwpkw7zPE4+SRXBqdQLMA0GCSqGSIb3DQEBCwUAMFkxCzAJBgNVBAYTAlVTMRUwEwYDVQQKEwxEaWdpQ2VydCBJbmMxMzAxBgNVBAMTKkRpZ2lDZXJ0IEdsb2JhbCBHMiBUTFMgUlNBIFNIQTI1NiAyMDIwIENBMTAeFw0yNTA5MTMwMDAwMDBaFw0yNjA5MTUyMzU5NTlaMFgxCzAJBgNVBAYTAkZSMRwwGgYDVQQHExNJU1NZIExFUyBNT1VMSU5FQVVYMRIwEAYDVQQKEwlPcmFuZ2UgU0ExFzAVBgNVBAMTDmltYXAub3JhbmdlLmZyMIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEA026T5Eb35xpyll37+vU24MQyyu7EdyofwMh94QddMmKKwzIleB4c+Aojitzf6a/VuENQBrlqLT0tgWB+KZ37VRrarsT/SMPS72+bp6jcm3KdrbM+vzE2zszEUEoGOlokRSx18Gu1XcIJGei0vUxg7mRQwP7PpS5tD5p1eSpEZIWDsR46aDG0UaCLBXiKbvwSfEc3ZdVJrDykVG+2q4LaFQhkSCu3u91hiYqyvAe/R+EMVsPWyz398PipBQ2abxvMxY6dXfW602A+U3VZ4VZTZ9fFRIo/0c/BBmg1dWGIf8s6Ldgce217kvR9C6jqO+u2p8ja1tKd2uMRluhiEqHghwIDAQABo4ID8jCCA+4wHwYDVR0jBBgwFoAUdIWAwGbH3zfez70pN6oDHb7tzRcwHQYDVR0OBBYEFCslKm5umELOKAzQsrjkwILBv1Q7MIGDBgNVHREEfDB6gg5pbWFwLm9yYW5nZS5mcoIPaW1hcDQub3JhbmdlLmZygg9pbWFwLndhbmFkb28uZnKCDXBvcC5vcmFuZ2UuZnKCDnBvcC53YW5hZG9vLmZygg5wb3AzLm9yYW5nZS5mcoIXcG9wLm1haWxzYW50ZS5vcmFuZ2UuZnIwPgYDVR0gBDcwNTAzBgZngQwBAgIwKTAnBggrBgEFBQcCARYbaHR0cDovL3d3dy5kaWdpY2VydC5jb20vQ1BTMA4GA1UdDwEB/wQEAwIFoDAdBgNVHSUEFjAUBggrBgEFBQcDAQYIKwYBBQUHAwIwgZ8GA1UdHwSBlzCBlDBIoEagRIZCaHR0cDovL2NybDMuZGlnaWNlcnQuY29tL0RpZ2lDZXJ0R2xvYmFsRzJUTFNSU0FTSEEyNTYyMDIwQ0ExLTEuY3JsMEigRqBEhkJodHRwOi8vY3JsNC5kaWdpY2VydC5jb20vRGlnaUNlcnRHbG9iYWxHMlRMU1JTQVNIQTI1NjIwMjBDQTEtMS5jcmwwgYcGCCsGAQUFBwEBBHsweTAkBggrBgEFBQcwAYYYaHR0cDovL29jc3AuZGlnaWNlcnQuY29tMFEGCCsGAQUFBzAChkVodHRwOi8vY2FjZXJ0cy5kaWdpY2VydC5jb20vRGlnaUNlcnRHbG9iYWxHMlRMU1JTQVNIQTI1NjIwMjBDQTEtMS5jcnQwDAYDVR0TAQH/BAIwADCCAXsGCisGAQQB1nkCBAIEggFrBIIBZwFlAHUA2AlVO5RPev/IFhlvlE+Fq7D4/F6HVSYPFdEucrtFSxQAAAGZQ3BUZgAABAMARjBEAiAvIiKISf7c7TC6taytT06dnQtmI3wDBd33hvxWMSEx5gIgWY9h3kvzHMXBqnK+l4HM4bRVl6JpsMsaRvhL5IAzaf0AdQDCMX5XRRmjRe5/ON6ykEHrx8IhWiK/f9W1rXaa2Q5SzQAAAZlDcFRoAAAEAwBGMEQCIGbZmUgBMGUuXH/pC9kndwgdQlAylTJCztVxM7C7zuu/AiBV1Th33ttl/9gVkACniJXi+iaNacRtgIPcpA0edEevoQB1AJROQ4f67MHvgfMZJCaoGGUBx9NfOAIBP3JnfVU3LhnYAAABmUNwVIAAAAQDAEYwRAIgHouteUB84A9aRkVOR6kuXgQTK8qbimakRANUMKluXH4CIHTb/KYQkh2Z/jhacvBQcJP4Jo/3l6jdJQBdo5Hvu+04MA0GCSqGSIb3DQEBCwUAA4IBAQC4LsfDq6MKTV2Uu8G1YbAZv27siDjM+0enqzCip71QIvX8iQmGD/ONah0Qtzb+pU9noUP9yT7L/QmtMlinQ46Phbk/8/IuwPWWEQ712eKdWOCasGDLOtIgoKFBB8AM604k8k63aW1IoPexHKDOkSRf4Rwxc08gbgtj4pW1Bfjn/3xJRkImz+A/5BnTj/F4WojC+MhN2dcjiX6FMTVUCjIxxpRg9tN1KIoRGsQGNHXPUdNUEOu0o0HMG619TXaYEg/T91Am7HoyFA+7VA/2NyMobvYhNSkHi5khRvZRZCPeGMfdct8dPZg/wtADuWmaQA51lR1VkJbHwBjynYHDJ0AYZgoyJpFcT/u7IImFpjLfBb3Dl5pUIkzVhYlpa26W6oMAAAAAAAAE+DCCBPQwggPcoAMCAQICEAhflMAthXvozBT/U+2iPiowDQYJKoZIhvcNAQELBQAwYTELMAkGA1UEBhMCVVMxFTATBgNVBAoTDERpZ2lDZXJ0IEluYzEZMBcGA1UECxMQd3d3LmRpZ2ljZXJ0LmNvbTEgMB4GA1UEAxMXRGlnaUNlcnQgR2xvYmFsIFJvb3QgRzIwHhcNMjAwOTI0MDAwMDAwWhcNMzAwOTIzMjM1OTU5WjBZMQswCQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMTMwMQYDVQQDEypEaWdpQ2VydCBHbG9iYWwgRzIgVExTIFJTQSBTSEEyNTYgMjAyMCBDQTEwggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQDM9xBiT6a7Y2/tkFJWxW0ne3oSVorx9PnW5+GPvZWr8mBBFXDbEgD6Jwq1VzhbfbJRk3GVDmpBlFs1G/p7+rvFviQw/lbvxPN9l+MU9RRNy6cQ8hbqqyLwMSIRYWmQJrp42Zcf431mq3VElXPIrP/vXQqKWUPhrLI6D/NI/NdrN8Fj3N5G1ttF/n0j/ZDoUQceUaNf7UlGVH8siMX0E5yXFTwD6KE53GkMMsGvFldMlEdCfKLInH3m1E1Ur0KZqMEEwnec1kjkzhHgKoCZ8ENwzz92a9FMSaskXsINgv1GqKtsk8xiUkJ1kvia+l5esrBh5R8fuX8JmOg9+oN/R2mhAgMBAAGjggGuMIIBqjAdBgNVHQ4EFgQUdIWAwGbH3zfez70pN6oDHb7tzRcwHwYDVR0jBBgwFoAUTiJUIBiV5uNu5g/6+rkS7QYXjzkwDgYDVR0PAQH/BAQDAgGGMB0GA1UdJQQWMBQGCCsGAQUFBwMBBggrBgEFBQcDAjASBgNVHRMBAf8ECDAGAQH/AgEAMHYGCCsGAQUFBwEBBGowaDAkBggrBgEFBQcwAYYYaHR0cDovL29jc3AuZGlnaWNlcnQuY29tMEAGCCsGAQUFBzAChjRodHRwOi8vY2FjZXJ0cy5kaWdpY2VydC5jb20vRGlnaUNlcnRHbG9iYWxSb290RzIuY3J0MHsGA1UdHwR0MHIwN6A1oDOGMWh0dHA6Ly9jcmwzLmRpZ2ljZXJ0LmNvbS9EaWdpQ2VydEdsb2JhbFJvb3RHMi5jcmwwN6A1oDOGMWh0dHA6Ly9jcmw0LmRpZ2ljZXJ0LmNvbS9EaWdpQ2VydEdsb2JhbFJvb3RHMi5jcmwwMAYDVR0gBCkwJzAHBgVngQwBATAIBgZngQwBAgEwCAYGZ4EMAQICMAgGBmeBDAECAzANBgkqhkiG9w0BAQsFAAOCAQEAdYvAPFvv/3Bca4r1Ie+sMeZDPYCv11WpHsOOGGx50/esQt+PiMWdtHXzyQj9iv5R8/KdIBoENc74tkF5r//Mll6U05odcC6iMYv7pcx/Vt8XN5e/wY1DhquMZn657YvxD4y11FWvXIme4KcqbbKjYzIYO8vetZ+DsxEBrCANkJcStymcNbXXkQ7vQG9tXDu9odn74ssudkDSOrssvxYL6r0DW06YOirtBVAHFZM8czmRlFpIDsbTSgGvZjm5vUI0HNsIA/NA/BLorjyritX7cnlkpuMOVbE7lT+tYDNniqy2p1zw7VpSG9Rh4SUS5ge1qpSy8Cj2YSZeVRz4Aet3cWYKMiaRXE/7uyCJhaYy3wW9w5eaVCJM1YWJaWtuluqDAAAAAAAAA5IwggOOMIICdqADAgECAhADOvHmpxGpoLsoZLEdCfrlMA0GCSqGSIb3DQEBCwUAMGExCzAJBgNVBAYTAlVTMRUwEwYDVQQKEwxEaWdpQ2VydCBJbmMxGTAXBgNVBAsTEHd3dy5kaWdpY2VydC5jb20xIDAeBgNVBAMTF0RpZ2lDZXJ0IEdsb2JhbCBSb290IEcyMB4XDTEzMDgwMTEyMDAwMFoXDTM4MDExNTEyMDAwMFowYTELMAkGA1UEBhMCVVMxFTATBgNVBAoTDERpZ2lDZXJ0IEluYzEZMBcGA1UECxMQd3d3LmRpZ2ljZXJ0LmNvbTEgMB4GA1UEAxMXRGlnaUNlcnQgR2xvYmFsIFJvb3QgRzIwggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQC7N8003HtrybJokK1Kdf9GuiEKCI31GVTJ+4jb867yOomRPHrmqwYaa8+sLeheCSREumKaftajqH7gVHUgBaxQt5xjGmww3NofGbHXHt791+DLlIM3ruwfQ07deyzSvS6lL+SpuK061JmktiXpm2sAYJJg/08hSRj3Z5CrYQacj/K66bTpkjJrtfNX6F0bzYwdq5UElUnzNS2W40lt3Xfj+0lLtKxVB6mPlbO0I7tMbUXw9qmylTC0/UxVjCdKVxR8gp3Nc5LTFkoGDIxQ0Y8eCb4XoeYhyv2D5RC8g6UKxGco9nMUFD1GdsOHFIkhNE2vD0UMpkmhurucxbEzgymFAgMBAAGjQjBAMA8GA1UdEwEB/wQFMAMBAf8wDgYDVR0PAQH/BAQDAgGGMB0GA1UdDgQWBBROIlQgGJXm427mD/r6uRLtBhePOTANBgkqhkiG9w0BAQsFAAOCAQEAYGcolG8OSGPrMd3qZxjViX08xYtKf+m+2ysX37Bfc3cqMhM5gWdChCPyRWc17Ii/+I+wYQw0pK4gTITG2/g14XbZ36ZCu8dECIZ/NnQkWtpsDRRZNb3ySd22H8mzDUcqPZkvu1y7tdQg4ZlfU0YV22ib8PMw1T4x4o2EnuOK2tqWPjUTpV/w+XBQcEdBEVcZTsCPrgbElRMXLxsln3XysY6ZoW8TsUFx/ogqyE8QIFXX8xRF5eBE9OqHlTKTDv5TRvosnf+LIrlL2QlFpN6kuJpY3Rt9Up+OWUOIgaSeJtVvrd0Nxjd97QOSG+V3X3buPI3EXVZbotlmbrM1N+UytgAAAAEAAAAAAAEAAAAAJXRsc2ZsYWdzMHgwMDAwMDAwMDppbWFwLm9yYW5nZS5mcjo5OTMAAA==  r4