Return-Path: <service-clientele@fnac.com>
Received: from opme11d3d01nd1.nor.fr.intraorange ([10.79.5.103])
	by opme11d3b64nd1.nor.fr.intraorange with LMTP
	id GJ+GNRREXGMqRAAAGW55dQ
	(envelope-from <service-clientele@fnac.com>); Fri, 28 Oct 2022 23:05:24 +0200
Received: from opme11ppr02nd1.nor.fr.intraorange ([10.79.5.103])
	by opme11d3d01nd1.nor.fr.intraorange with LMTP
	id gPptNRREXGM6OQAA7epNww
	(envelope-from <service-clientele@fnac.com>)
	for <MELOFR-200-jIRfDsq6shSq7o+X46PZ+b87jjyz6dFxAN9w3nnewhc=>; Fri, 28 Oct 2022 23:05:24 +0200
Received: from opmta1mti38nd1 ([10.79.5.103])
	by opme11ppr02nd1.nor.fr.intraorange with LMTP
	id 8NI5NRREXGPGGgAApmNZRA
	(envelope-from <service-clientele@fnac.com>)
	for <marc.malroux@orange.fr>; Fri, 28 Oct 2022 23:05:24 +0200
Received: from mta1.fnacdarty.com ([193.108.68.1])
	by smtp.orange.fr with ESMTP
	id oWXcopVM7FNmtoWXcoKcVU; Fri, 28 Oct 2022 23:05:24 +0200
X-bcc: marc.malroux@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (50)(0000)gggruggvucftvghtrhhoucdtuddrgedvgedrtdeigdduheehucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrihhlohhuthemucehtddtnecuhdfknhhvihhsihgslhgvucifohhrughsucdlhedtmdenucfjughrpefvufffshfhrhggtgfgsehhkedttddttdejnecuhfhrohhmpefhnhgrtgcuofgrrhhkvghtrfhlrggtvgcuoehsvghrvhhitggvqdgtlhhivghnthgvlhgvsehfnhgrtgdrtghomheqnecuggftrfgrthhtvghrnhepteeguedvvdeutddtfeejffeguefhtdfhkefgvdeukefgheehhfeiveelhedugfevnecuffhomhgrihhnpehfnhgrtgdrtghomhdpghhlshdqghhrohhuphdrvghupdgrphhplhgvrdgtohhmpdhgohhoghhlvgdrtghomhdpfhgrtggvsghoohhkrdgtohhmpdhtfihithhtvghrrdgtohhmpdihohhuthhusggvrdgtohhmnecukfhppeduleefrddutdekrdeikedrudenucevlhhushhtvghrufhiiigvpedunecurfgrrhgrmhephhgvlhhopehmthgruddrfhhnrggtuggrrhhthidrtghomhdpihhnvghtpeduleefrddutdekrdeikedruddpmhgrihhlfhhrohhmpehsvghrvhhitggvqdgtlhhivghnthgvlhgvsehfnhgrtgdrtghomhdprhgtphhtthhopehmrghrtgdrmhgrlhhrohhugiesohhrrghnghgvrdhfrhdpnhgspghrtghpthhtohepud
X-me-spamlevel: not-spam
X-ME-Helo: mta1.fnacdarty.com
X-ME-IP: 193.108.68.1
X-ME-Entity: ofr
Received: from fcsmpweb4.fnac.com (unknown [10.178.39.87])
	by mta1.fnacdarty.com (Postfix) with ESMTPS id 4F76C126D0B
	for <marc.malroux@orange.fr>; Fri, 28 Oct 2022 23:05:24 +0200 (CEST)
DKIM-Filter: OpenDKIM Filter v2.11.0 mta1.fnacdarty.com 4F76C126D0B
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fnac.com; s=dkimmtp;
	t=1666991124; bh=Q/Y4vwannz4cTEzd7OiZnbXzAjXBzU56ZhQ8prlOV0o=;
	h=To:Subject:Date:From:Reply-To:From;
	b=D3wbrUOx9bKEUs4+HjBgUIwOE+8dvMG++fXfrsQIeCB6EJ5UDKMay+dAZcjvWlm22
	 pmVmi2H4cvopj9IA3nWg7UI5KTWVSussIFnF4//T/xZy4Cpai7rtoSXynsznb6zGmv
	 QnBb9Mikw6Z0nYbwZhG/yKOy6/sW/mGGBVrmgCeIj6MPztBgqkTEeyL/AtG9I279nd
	 gzeuXPzKaYF8KVNPXf2RdSF9D3j2XNkX5mb6yeRCxe/4wDzwsGbs/2G5cIatNhSjIV
	 a+N1HU41TR5mjQhkMAE/dZiJyuc3o+dbQDOgfgu+Ze2QDxTWN2jBWyjAl7eok2zAxj
	 Rhw07zr5U0Fnw==
Received: by fcsmpweb4.fnac.com (FnacDarty, from userid 1000)
	id 462CF2E528; Fri, 28 Oct 2022 23:05:24 +0200 (CEST)
To: KARINE L. <marc.malroux@orange.fr>
Subject: =?UTF-8?Q?Get=20Goods=20vous=20a=20envoy=C3=A9=20un=20message=20au=20?=  =?UTF-8?Q?sujet=20de=20votre=20commande=20Fnac.com=20n=C2=B0=20ENDEMOFUUDOHE?=
X-PHP-Originating-Script: 1000:Sendmail.php
Date: Fri, 28 Oct 2022 23:05:24 +0200
Sender: Fnac MarketPlace <service-clientele@fnac.com>
From: Fnac MarketPlace <service-clientele@fnac.com>
Reply-To: Fnac MarketPlace <service-clientele@fnac.com>
MIME-Version: 1.0
Content-Type: text/html; charset=UTF-8
Content-Transfer-Encoding: 8bit
Message-Id: <20221028210524.462CF2E528@fcsmpweb4.fnac.com>

<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN"
"http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd">
<html xmlns="http://www.w3.org/1999/xhtml" style="margin-top:
-8px;margin-bottom: -8px;border-bottom-width: -0px;border-bottom-style:
solid;margin-right: -8px;margin-left: -8px;">
<head>
    <meta http-equiv="Content-Type" content="text/html; charset=utf-8">
    <meta name="viewport"
          content="target-densitydpi=device-dpi, width=device-width,
initial-scale=1, maximum-scale=1, minimum-scale=1 user-scalable=no">
</head>
<style type="text/css">
    @font-face {
        font-family: 'Roboto';
        font-style: normal;
        font-weight: 100;
        src:
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-100-v15.eot');
        src:
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-100-v15.eot?#iefix')
format('embedded-opentype'),
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-100-v15.woff2')
format('woff2'),
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-100-v15.woff')
format('woff'),
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-100-v15.svg')
format('svg')
    }

    @font-face {
        font-family: 'Roboto';
        font-style: normal;
        font-weight: 300;
        src:
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-300-v15.eot');
        src:
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-300-v15.eot?#iefix')
format('embedded-opentype'),
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-300-v15.woff2')
format('woff2'),
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-300-v15.woff')
format('woff'),
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-300-v15.svg')
format('svg')
    }

    @font-face {
        font-family: 'Roboto';
        font-style: normal;
        font-weight: 400;
        src:
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-400-v15.eot');
        src:
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-400-v15.eot?#iefix')
format('embedded-opentype'),
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-400-v15.woff2')
format('woff2'),
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-400-v15.woff')
format('woff'),
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-400-v15.svg')
format('svg')
    }

    @font-face {
        font-family: 'Roboto';
        font-style: normal;
        font-weight: 700;
        src:
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-700.eot');
        src:
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-700-v15.eot?#iefix')
format('embedded-opentype'),
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-700-v15.woff2')
format('woff2'),
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-700-v15.woff')
format('woff'),
url('https://static.fnac-static.com/multimedia/fnacdirect/fonts/Roboto-700-v15.svg')
format('svg')
    }

    @media only screen and (max-width: 680px) {
        center {
            min-width: 0 !important
        }
    }

    @media only screen and (max-width: 680px) {
        table.container {
            width: auto !important;
            display: block !important;
            margin-left: 10px !important;
            margin-right: 10px !important
        }
    }

    @media only screen and (max-width: 660px) {
        .title {
            font-size: 24px !important;
            line-height: 28px !important
        }
    }

    @media only screen and (max-width: 660px) {
        .header {
            max-width: none !important;
            width: 100% !important
        }
    }

    @media only screen and (max-width: 680px) {
        .headerInfo {
            padding-right: 6px !important;
            width: 100% !important
        }
    }

    @media only screen and (max-width: 660px) {
        .header-logoTxt {
            line-height: 35px !important;
            width: auto !important
        }
    }

    @media only screen and (max-width: 400px) {
        .header-logoTxt {
            font-size: 13px !important
        }
    }

    @media only screen and (max-width: 420px) {
        .header-logoTxt--hideForMobile {
            display: none !important;
            font-size: 0 !important
        }

        .header-logoTxt--showForMobile {
            font-size: 13px !important;
            display: inline !important
        }
    }

    @media only screen and (max-width: 660px) {
        .header-logoVisual {
            width: 84px !important;
            height: 35px !important
        }
    }

    @media only screen and (max-width: 660px) {
        .header-logoVisual a {
            width: 84px !important
        }

        .header-logoVisual img {
            max-width: 84px !important;
            float: none !important;
            margin: 0 auto !important
        }
    }

    @media only screen and (max-width: 660px) {
        .headerInfo-commandTxt {
            font-size: 13px !important;
            padding-top: 16px !important
        }
    }

    @media only screen and (max-width: 660px) {
        .header-logoImg {
            height: 35px !important
        }
    }

    @media only screen and (max-width: 660px) {
        .footerLinks-txt {
            font-size: 12px !important
        }
    }

    @media only screen and (max-width: 420px) {
        .footerLinks-threeCol {
            width: 100% !important;
            display: table !important;
            text-align: left !important;
            -moz-box-sizing: border-box !important;
            -webkit-box-sizing: border-box !important;
            box-sizing: border-box !important;
            table-layout: fixed !important
        }

        .footerLinks-threeCol .footerLinks-link {
            display: table-row !important;
            width: 100%;
            border-bottom: 1px solid #d9d9d9
        }

        .footerLinks-link > div,
        .footerLinks-threeCol .footerLinks-txt {
            display: table-cell !important
        }

        .footerLinks-link > div {
            width: 49px !important;
            max-width: none
        }

        .footerLinks-threeCol .footerLinks-txt {
            text-align: left !important;
            vertical-align: middle !important;
            padding-left: 20px
        }

        .footerLinks-txt > span {
            display: inline !important
        }
    }

    @media only screen and (max-width: 580px) {
        .footerServiceClient {
            display: none !important
        }
    }

    @media only screen and (max-width: 680px) {
        .footerServiceClient-line {
            display: table !important;
            width: 100% !important;
            table-layout: fixed !important
        }
    }

    @media only screen and (min-width: 540px) and (max-width: 600px) {
        .footerServiceClient-container {
            padding: 0 20px !important
        }
    }

    @media only screen and (max-width: 539PX) {
        .footerServiceClient-container {
            padding: 0 !important
        }
    }

    @media only screen and (max-width: 660px) {
        .footerMore-apps {
            display: none !important;
            width: 0 !important
        }
    }

    @media only screen and (max-width: 660px) {
        .footerMore-commmunity-table {
            table-layout: fixed !important;
            margin: 0 auto !important;
            width: 80% !important
        }
    }

    @media only screen and (max-width: 680px) {
        .footerMore-commmunity-td {
            text-align: center !important;
            width: auto !important
        }
    }

    @media only screen and (max-width: 660px) {
        .footerMore-commmunity-td img {
            float: none !important;
            display: inline !important
        }
    }

    @media only screen and (max-width: 600px) {
        .footerMentions {
            padding: 0 10px !important
        }
    }

    @media only screen and (max-width: 480px) {
        .blocHello {
            padding: 20px !important
        }
    }

    @media only screen and (max-width: 380px) {
        .blocHello {
            padding: 15px !important
        }
    }

    @media only screen and (max-width: 660px) {
        .blocHello-message {
            font-size: 24px !important;
            line-height: 30px !important
        }
    }

    @media only screen and (max-width: 660px) {
        .blocMessage {
            padding: 14px !important
        }
    }

    @media only screen and (max-width: 420px) {
        .warning-picto--orderConfirmation {
            width: 31px !important;
            padding-left: 15px !important;
            padding-right: 15px !important
        }

        .warning-txt {
            padding-right: 20px !important;
            font-size: 13px !important
        }
    }

    @media only screen and (max-width: 528px) {
        .shippingBilling-col {
            width: 100% !important;
            display: block !important
        }

        .shippingBilling-col--brd .shippingBilling-table {
            border-right: none !important
        }

        .shippingBilling-col--brd {
            border-bottom: 1px solid #f2f2f2 !important
        }
    }

    @media only screen and (max-width: 680px) {
        .shippingBilling-pdg {
            font-size: 18px !important;
            line-height: 18px !important
        }
    }

    @media only screen and (max-width: 600px) {
        .shippingBilling-content {
            padding-left: 20px !important;
            padding-right: 20px !important
        }
    }

    @media only screen and (max-width: 680px) {
        .shippingBilling-headerTitle {
            font-size: 18px !important;
            line-height: 20px !important
        }
    }

    @media only screen and (max-width: 680px) {
        .shippingBilling-headerPicto {
            width: 40px !important
        }

        .shippingBilling-headerPicto--billing {
            width: 32px !important;
            height: auto !important
        }
    }

    @media only screen and (min-width: 580px) and (max-width: 680px) {
        .blocProductWithImg {
            width: 55% !important
        }
    }

    @media only screen and (min-width: 480px) and (max-width: 579px) {
        .blocProductWithImg {
            width: 63% !important
        }
    }

    @media only screen and (min-width: 380px) and (max-width: 479px) {
        .blocProductWithImg {
            width: 77% !important
        }
    }

    @media only screen and (max-width: 379px) {
        .blocProductWithImg {
            width: 94% !important
        }
    }

    @media only screen and (max-width: 660px) {
        .blocProductWithImg .blocProduct-img {
            width: 40% !important
        }

        .blocProductWithImg .blocProduct-desc {
            width: 60% !important
        }
    }

    @media only screen and (max-width: 680px) {
        .twoProductsWithImg .twoProducts-col {
            width: 100% !important;
            display: block !important
        }
    }

    @media only screen and (max-width: 680px) {
        .twoProductsWithImg .twoProducts-col {
            text-align: center !important
        }

        .twoProductsWithImg .twoProducts-col .blocProductWithImg {
            display: inline-table !important;
            table-layout: fixed !important
        }
    }

    @media only screen and (max-width: 480px) {
        .payment-tdKey,
        .payment-tdValue {
            font-size: 15px !important
        }
    }

    @media only screen and (max-width: 480px) {
        .blocButton-table {
            width: 100% !important;
            display: table !important
        }
    }

    @media only screen and (max-width: 480px) {
        .blocButton-txtTable {
            width: 100% !important
        }
    }

    @media(max-width : 200px) {
        .oneProductWithImg {
            border-collapse: collapse;
            border-spacing: 0;
            padding: 0;
            table-layout: fixed;
            text-align: left;
            vertical-align: top;
            width: 100%;
        }
    }

    @media only screen and (max-width: 480px) {
        .oneProductWithImg {
            width: 100% !important;
        }
    }
</style>
<div class="bgSilver" style="background-color: #f2f2f2;">
    <table class="body"
           style="background-color: #f2f2f2; border-collapse: collapse;
border-spacing: 0; color: #222222; font-family: 'Roboto', Helvetica, Arial,
sans-serif; font-size: 14px; font-weight: normal; height: 100%; line-height:
19px; margin: 0; padding: 0; text-align: left; vertical-align: top; width:
100%;">
        <tbody>
        <tr style="padding: 0; text-align: left; vertical-align: top;">
            <td class="center" align="center" valign="top"
                style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens: auto;
line-height: 19px; margin: 0; padding: 0; text-align: center; vertical-align:
top; word-break: break-word;">
                <center style="min-width: 580px; width: 100%;">
                                            <table class="header"
style="background: #232323; background-color: #232323; border-collapse:
collapse; border-spacing: 0; display: table; padding: 0px; position: relative;
text-align: left; vertical-align: top; width: 100%;">
    <tbody>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="center" align="center" bgcolor="#232323" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding: 0;
text-align: center; vertical-align: top; word-break: break-word;">
            <table class="container container--header" style="-moz-box-sizing:
border-box; -webkit-box-sizing: border-box; Margin: 0 auto; border-collapse:
collapse; border-spacing: 0; box-sizing: border-box; margin: 0 auto; overflow:
hidden; padding: 0; table-layout: fixed; text-align: left; vertical-align: top;
min-width: 660px;width: 660px;">
                <tbody>
                <tr style="padding: 0; text-align: left; vertical-align: top;">
                    <td style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens: auto;
line-height: 19px; margin: 0; padding: 0; text-align: left; vertical-align: top;
word-break: break-word;">
                        <table class="header-container" style="border-collapse:
collapse; border-spacing: 0; padding: 0; table-layout: fixed; text-align: left;
vertical-align: top; width: 100%;">
                            <tbody>
                            <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                <td class="header-logoVisual"
                                    style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal; height:
54px; hyphens: auto; line-height: 19px; margin: 0; padding: 0; text-align: left;
vertical-align: top; min-width: 121px;width: 121px; word-break: break-word;">
                                                                        <a
href="https://www.fnac.com" target="_blank"
                                       style="display: block; text-decoration:
none; min-width: 121px;width: 121px;">
                                        <img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive/expedition-common/logoTop2.gif"
                                             alt="Fnac"
                                             style="-ms-interpolation-mode:
bicubic; border: none; display: block; height: auto; max-width: 100%; outline:
none; text-decoration: none; width: auto;">
                                    </a>
                                </td>
                                                                    <td
class="header-logoTxt" valign="middle" align="right" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #fff; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: bold;
hyphens: auto; line-height: 19px; margin: 0; padding: 0; text-align: right;
vertical-align: middle; width: 100%; word-break: break-word;">
                                                                               
<span class="header-logoTxt--showForMobile" style="display: none; font-size:
0;">Votre <span class="txtMustard" style="color:
#eab011;">commande</span></span>&nbsp;&nbsp;
                                        <span
class="header-logoTxt--hideForMobile">Des nouvelles de votre <span
class="txtMustard" style="color: #eab011;">commande</span>&nbsp;&nbsp;</span>
                                    </td>
                                                            </tr>
                            </tbody>
                        </table>
                    </td>
                </tr>
                </tbody>
            </table>
        </td>
    </tr>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="center bgSilver" align="center" style="-moz-hyphens: auto;
-webkit-hyphens: auto; background-color: #f2f2f2; border-collapse: collapse;
color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
14px; font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding:
0; text-align: center; vertical-align: top; word-break: break-word;">
            <table class="container" style="-moz-box-sizing: border-box;
-webkit-box-sizing: border-box; Margin: 0 auto; border-collapse: collapse;
border-spacing: 0; box-sizing: border-box; margin: 0 auto; overflow: hidden;
padding: 0; table-layout: fixed; text-align: left; vertical-align: top;
min-width: 660px;width: 660px;">
                <tbody>
                <tr style="padding: 0; text-align: left; vertical-align: top;">
                    <td class="header-logoVisual" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
height: 54px; hyphens: auto; line-height: 19px; margin: 0; padding: 0;
text-align: left; vertical-align: top; min-width: 121px;width: 121px;
word-break: break-word;">
                        <a class="logo_fnac" href="https://www.fnac.com"
target="_blank" style="display: block; text-decoration: none; min-width:
121px;width: 121px;">
                            <img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive/expedition-common/logoBottom.gif"
style="-ms-interpolation-mode: bicubic; border: none; display: block; height:
auto; max-width: 100%; outline: none; text-decoration: none; width: auto;">
                        </a>
                    </td>
                    <td class="headerInfo" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 0 0 20px 0; text-align:
right; vertical-align: middle; word-break: break-word;">
                        <p class="headerInfo-commandTxt" style="color: #222222;
display: inline-block; font-family: 'Roboto', Helvetica, Arial, sans-serif;
font-size: 16px; font-weight: normal; line-height: 19px; margin: 0; padding: 0;
padding-top: 25px; text-align: right;">
                            <span class="txtGrey" style="color: #777777;">NÂ° de
commande : </span>
                            <span class="headerInfo-number" style="color:
#000000; font-weight: bold;">ENDEMOFUUDOHE</span>
                        </p>
                    </td>
                </tr>
                </tbody>
            </table>
        </td>
    </tr>
    </tbody>
</table>
                    
                
                <table class="container"
       style="-moz-box-sizing: border-box; -webkit-box-sizing: border-box;
Margin: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizing:
border-box; margin: 0 auto; overflow: hidden; padding: 0; table-layout: fixed;
text-align: left; vertical-align: top; min-width: 660px;width: 660px;">
    <tbody>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="blocHello"
            style="-moz-hyphens: auto; -webkit-hyphens: auto; background-color:
#ffffff; border-collapse: collapse; box-sizing: border-box; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding: 30px;
text-align: left; vertical-align: top; min-width: 100%;width: 100%; word-break:
break-word;">
            <table class="blocHello-table"
                   style="border-collapse: collapse; border-spacing: 0; padding:
0; table-layout: fixed; text-align: left; vertical-align: top; min-width:
100%;width: 100%;">
                <tbody>
                <tr style="padding: 0; text-align: left; vertical-align: top;">
                    <td class="blocHello-message center"
                        style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 35px; font-weight: lighter; hyphens: auto;
line-height: 45px; margin: 0; padding: 0; text-align: center; vertical-align:
top; word-break: break-word;">
                                                                                
                                                                                
                                                  Bonjour <span
class="txtMustard txtBold" style="color: #eab011; font-weight:
bold;">KARINE</span> !
                        
                                <br>
                                                    Vous avez reÃ§u un message
                                                                </td>
                </tr>
                </tbody>
            </table>
        </td>
    </tr>
    </tbody>
</table>
<br>
            <table class="container"
       style="-moz-box-sizing: border-box; -webkit-box-sizing: border-box;
Margin: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizing:
border-box; margin: 0 auto; overflow: hidden; padding: 0; table-layout: fixed;
text-align: left; vertical-align: top; min-width: 660px;width: 660px;">
    <tbody>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="blocMessage"
            style="-moz-hyphens: auto; -webkit-hyphens: auto; background-color:
#ffffff; border-collapse: collapse; box-sizing: border-box; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding: 20px;
text-align: center; vertical-align: top; min-width: 100%;width: 100%;
word-break: break-word;">
            <table class="blocMessage-table"
                   style="border-collapse: collapse; border-spacing: 0; padding:
0; table-layout: fixed; text-align: left; vertical-align: top; min-width:
100%;width: 100%;">
                <tbody>
                <tr style="padding: 0; text-align: left; vertical-align: top;">
                    <td style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens: auto;
line-height: 19px; margin: 0; padding: 0; text-align: left; vertical-align: top;
word-break: break-word;">
                                    Nous vous remercions de bien vouloir prendre
connaissance du message de <span class="txtMustard txtBold" style="color:
#eab011; font-weight: bold;">votre vendeur partenaire</span>.<br />
            <br />
                            Get Goods<br />
                <br />
                        <br />
<br />
Please find the English version below!<br />
Pour franÃ§aise sÂ´il vous plaÃ®t dÃ©filer!<br />
<br />
<br />
Guten Tag,<br />
<br />
vielen Dank fÃ¼r Ihre Bestellung.<br />
<br />
Folgende Sendung hat soeben unser Logistik-Zentrum verlassen und ist auf dem<br
/>
Weg zu Ihnen. Bitte haben Sie daher VerstÃ¤ndnis, dass Ã„nderungen der<br />
Bestell- bzw. Lieferdaten nicht mehr mÃ¶glich sind.<br />
<br />
Auftragsnummer        : 1094102008<br />
Rechnungsnummer   : 9129413180<br />
Kundennummer         : 161171620<br />
Bestellnummer d.KD.: ENDEMOFUUDOHE<br />
Bestell-Datum            : 28.10.2022<br />
Zahlungsbedingung   : Bereits bezahlt Ã¼b. Marktplatz<br />
Rechnungsbetrag      : 35,94 EUR<br />
<br />
<br />
Ihr Paket wird geliefert an:<br />
      LACAZE<br />
      KARINE<br />
      3 Cote de Dezes SAINT ETIENNE DE<br />
<br />
      FR 15600 SAINT ETIENNE DE MAURS<br />
<br />
<br />
Ihr Paket beinhaltet folgende Artikel:<br />
<br />
     Menge         Artikel   Artikelbezeichnung<br />
-------------------------------------------------------------------<br />
         1 ST  x   X900982 Adventskalender Horse Club 2022<br />
<br />
<br />
Aus versandtechnischen GrÃ¼nden kann es vorkommen, dass wir eine mehrteilige<br
/>
Bestellung ggf. in mehrere Warensendungen aufteilen. In diesem Fall erhalten<br
/>
Sie separate LieferbestÃ¤tigungen per E-Mail.<br />
SelbstverstÃ¤ndlich entstehen Ihnen dadurch keine weiteren Kosten.<br />
<br />
<br />
Sie mÃ¶chten gerne erfahren, wo Ihr Paket sich gerade befindet?<br />
<br />
Sie brauchen nur Ihre Sendungsnummer: 00GAAHKJ<br />
Ãœber folgenden Link kÃ¶nnen Sie den Lieferstatus Ihrer Sendung verfolgen:<br />
https://gls-group.eu/DE/de/paketverfolgung?match=00GAAHKJ<br />
<br />
Bitte beachten Sie, dass es ca. einen Werktag dauern kann, bis Ihr<br />
Versandstatus im Paketverlauf sichtbar ist.<br />
Sollte der Trackinglink noch nichts anzeigen, bitten wir um etwas Geduld.<br />
<br />
<br />
Wir freuen uns darauf, Sie bald wieder bei uns begrÃ¼ÃŸen zu dÃ¼rfen.<br />
<br />
Mit freundlichen GrÃ¼ÃŸen<br />
Ihr getgoods-Team<br />
<br />
<br />
====================================================================================<br
/>
<br />
<br />
Dear getgoods customer,<br />
<br />
many thanks for your order.<br />
<br />
The following shipment has just left our logistic department. We ask for<br />
your understanding that changes of the order are not possible anymore<br />
<br />
Order number       : 1094102008<br />
Invoice number     : 9129413180<br />
Customer number: 161171620<br />
Order reference    : ENDEMOFUUDOHE<br />
Order date            : 28.10.2022<br />
Payment term       : Already Paid via marketplace<br />
Invoice amount     : 35,94 EUR<br />
<br />
<br />
The package will be delivered to:<br />
      LACAZE<br />
      KARINE<br />
      3 Cote de Dezes SAINT ETIENNE DE<br />
<br />
      FR 15600 SAINT ETIENNE DE MAURS<br />
<br />
<br />
The package includes the following:<br />
<br />
     Quantity      Article &amp; Product description<br />
-------------------------------------------------------------------<br />
         1 ST  x   X900982 Adventskalender Horse Club 2022<br />
<br />
<br />
Please note that orders with more products could be sent in more than one<br />
package. In this case you will receive a separate delivery confirmation via<br
/>
e-mail. Of course no additional cost will occur.<br />
<br />
<br />
<br />
The package number of your shipment is: 00GAAHKJ<br />
You can track the delivery status of your parcel via the link below:<br />
https://gls-group.eu/DE/de/paketverfolgung?match=00GAAHKJ<br />
<br />
We ask for your understanding that it might take about one business day<br />
until the tracking details are visible.<br />
<br />
If the link is not working yet, then we ask for a little patience.<br />
<br />
<br />
We hope to see you again soon.<br />
<br />
Best regards<br />
Your getgoods Team<br />
<br />
<br />
====================================================================================<br
/>
<br />
<br />
Bonjour,<br />
<br />
Nous vous remercions pour votre commande.<br />
<br />
Lâ€™envoi suivant vient de quitter notre centre logistique et se trouve en
chemin.<br />
Veuillez noter quâ€™une modification des coordonnÃ©es de commande<br />
ou de livraison nâ€™est plus possible.<br />
<br />
NumÃ©ro dâ€™ordre                          : 1094102008<br />
NumÃ©ro de facture                     : 9129413180<br />
NumÃ©ro client                             : 161171620<br />
NumÃ©ro de commande du client: ENDEMOFUUDOHE<br />
Date de commande                    : 28.10.2022<br />
ModalitÃ©s de paiement               : DÃ©ja payÃ© sur Marketplace<br />
Montant de facture                     : 35,94 EUR<br />
<br />
<br />
Votre colis est livrÃ© â€™a lâ€™adresse suivante:<br />
      LACAZE<br />
      KARINE<br />
      3 Cote de Dezes SAINT ETIENNE DE<br />
<br />
      FR 15600 SAINT ETIENNE DE MAURS<br />
<br />
<br />
Votre colis contient les articles suivants:<br />
<br />
     QuantitÃ©      NumÃ©ro et DÃ©signation de lâ€™article<br />
-------------------------------------------------------------------<br />
         1 ST  x   X900982 Adventskalender Horse Club 2022<br />
<br />
<br />
Il peut arriver, pour des raisons de contraintes dâ€™expÃ©dition,<br />
que nous devrons Ã©ventuellement diviser une commande de plusieurs piÃ¨ces en
plusieurs colis.<br />
Dans ce cas, vous recevrez des confirmations de livraison sÃ©parÃ©es par
courriel.<br />
Bien sÃ»r, il ne sâ€™en suit aucun coÃ»t supplÃ©mentaire pour vous.<br />
<br />
<br />
Vous dÃ©sirez savoir ou se trouve votre colis actuellement?<br />
<br />
Tout ce quâ€™il vous faut est votre numÃ©ro de suivi.: 00GAAHKJ<br />
Par le lien suivant, vous pouvez suivre le statut de votre livraison:<br />
https://gls-group.eu/DE/de/paketverfolgung?match=00GAAHKJ<br />
<br />
Veuillez noter quâ€™il se peut que le statut dâ€™expÃ©dition de votre colis soit
visible<br />
avec un jour de retard dans votre suivi dâ€™envois.<br />
Si le lien de tracking nâ€™affiche encore rien, nous vous demandons un peu de
patience.<br />
<br />
<br />
Nous serions ravis de vous acceuillir prochainement de nouveau sur notre
site.<br />
<br />
Meilleures salutations<br />
Lâ€™Ã©quipe getgoods<br />
<br />
<br />
<br />
get your goods GmbH<br />
<br />
Nordring 98 a<br />
<br />
D-90409 NÃ¼rnberg<br />
<br />
GeschÃ¤ftsfÃ¼hrer: Heiko Voigt<br />
<br />
Handelsregister: Amtsgericht NÃ¼rnberg, HRB 26515<br />
<br />
<br />
            <br />
                <table class="container" style="-moz-box-sizing: border-box;
-webkit-box-sizing: border-box; border-collapse: collapse; border-spacing: 0;
box-sizing: border-box; margin: 0 auto; overflow: hidden; padding: 0;
table-layout: fixed; text-align: left; vertical-align: top; width: 100%;">
    <tbody>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="center" style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens: auto;
line-height: 19px; margin: 0; padding: 0; text-align: center; vertical-align:
top; word-break: break-word;">
                <table class="blocButton-table blocButton-table--mustard"
style="border-collapse: collapse; border-spacing: 0; display: inline-table;
height: 41px; margin: 0 auto; padding: 0; table-layout: fixed; text-align:
center; vertical-align: top;">
                <tbody>
                <tr style="background-color: #f5b027; padding: 0; text-align:
left; vertical-align: top;">
                    <td width="41" class="blocButton-img" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; height: 41px; hyphens: auto; line-height: 19px; margin: 0;
padding: 0; text-align: left; vertical-align: top; width: 41px; word-break:
break-word;">
                        <a
href="https://mp.fnac.com/compte/commande/ENDEMOFUUDOHE#message"
title="Visualiser votre message" target="_blank" style="display: block; height:
41px; text-decoration: none; width: 41px;"><img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive2016/btn/btn--silver-mustard-left.gif"
width="41" height="41" style="-ms-interpolation-mode: bicubic; border: none;
display: inline; height: 41px; max-width: none; outline: none; text-decoration:
none; width: 41px;"></a>
                    </td>
                    <td class="blocButton-txt" style="-moz-box-sizing:
border-box; -moz-hyphens: auto; -webkit-box-sizing: border-box; -webkit-hyphens:
auto; border-collapse: collapse; box-sizing: border-box; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; height: 41px; hyphens: auto; line-height: 19px; margin: 0;
padding: 0; text-align: center; vertical-align: top; word-break: break-word;">
                        <table class="blocButton-txtTable
blocButton-txtTable--mustard" style="-moz-box-sizing: border-box;
-webkit-box-sizing: border-box; border-collapse: collapse; border-spacing: 0;
box-sizing: border-box; height: 41px; padding: 0; table-layout: fixed;
text-align: left; vertical-align: middle;">
                            <tbody>
                            <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                <td class="blocButton-txtTd"
style="-moz-box-sizing: border-box; -moz-hyphens: auto; -webkit-box-sizing:
border-box; -webkit-hyphens: auto; border-collapse: collapse; box-sizing:
border-box; color: #222224; font-family: 'Roboto', Helvetica, Arial, sans-serif;
font-size: 14px; font-weight: normal; height: 39px; hyphens: auto; line-height:
19px; margin: 0; padding: 0; text-align: center; vertical-align: middle;
word-break: break-word;">
                                    <a class="blocButton-txtLink--mustard "
href="https://mp.fnac.com/compte/commande/ENDEMOFUUDOHE#message"
title="Visualiser votre message" target="_blank" style="color: #ffffff;
font-size: 19px; font-weight: bold; text-decoration: none;">
                                        Visualiser votre message
                                    </a>
                                </td>
                            </tr>
                            </tbody>
                        </table>
                    </td>
                    <td width="41" class="blocButton-img" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; height: 41px; hyphens: auto; line-height: 19px; margin: 0;
padding: 0; text-align: left; vertical-align: top; width: 41px; word-break:
break-word;">
                        <a
href="https://mp.fnac.com/compte/commande/ENDEMOFUUDOHE#message"
title="Visualiser votre message" target="_blank" style="display: block; height:
41px; text-decoration: none; width: 41px;"><img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive2016/btn/btn--silver-mustard-right.gif"
width="41" height="41" style="-ms-interpolation-mode: bicubic; border: none;
display: inline; height: 41px; max-width: none; outline: none; text-decoration:
none; width: 41px;"></a>
                    </td>
                </tr>
                </tbody>
            </table>
        </td>
    </tr>
    </tbody>
</table>
    <br />
            <br />
        
                    </td>
                </tr>
                </tbody>
            </table>
        </td>
    </tr>
    </tbody>
</table>
<br>

            
                    <table class="container"
       style="-moz-box-sizing: border-box; -webkit-box-sizing: border-box;
border-collapse: collapse; border-spacing: 0; box-sizing: border-box; margin: 0
auto; overflow: hidden; padding: 0; table-layout: fixed; text-align: left;
vertical-align: top; width: 660px;">
    <tbody>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
                    <td class="title"
                style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; display: block; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 32px; font-weight: lighter;
hyphens: auto; line-height: 43px; margin: 0; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;">
                Votre commande
            </td>
            </tr>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="title-break"
            style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse:
collapse; color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif;
font-size: 8px; font-weight: normal; hyphens: auto; line-height: 8px; margin: 0;
mso-line-height-rule: exactly; padding: 0; text-align: left; vertical-align:
top; word-break: break-word;">
            &nbsp;
        </td>
    </tr>
    </tbody>
</table>

<table class="container"
       style="-moz-box-sizing: border-box; -webkit-box-sizing: border-box;
border-collapse: collapse; border-spacing: 0; box-sizing: border-box; margin: 0
auto; overflow: hidden; padding: 0; table-layout: fixed; text-align: left;
vertical-align: top; width: 660px; background-color: white">
    <tbody>
                        <tr style="padding: 0; text-align: left; vertical-align:
top;">
    <td class="oneProduct-container"
        style="-moz-hyphens: auto; -webkit-hyphens: auto; background: #ffffff;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 14px; font-weight: normal; height: 100%; hyphens:
auto; line-height: 19px; margin: 0; padding: 0; text-align: center;
vertical-align: top; word-break: break-word;">
        <table class="oneProduct"
               style="background: #ffffff; border-bottom: 1px solid #f2f2f2;
border-collapse: collapse; border-spacing: 0; border-top: 1px solid #f2f2f2;
height: 100%; padding: 0; text-align: left; vertical-align: top;">
            <tr style="padding: 0; text-align: left; vertical-align: top;">
                <td style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens: auto;
line-height: 28px; margin: 0; mso-line-height-rule: exactly; padding: 0;
text-align: left; vertical-align: top; word-break: break-word;">
                    <img
src="https://static.fnac-static.com/multimedia/fnacdirect/neolane/responsive/expedition-common/spacer.gif"
                         style="-ms-interpolation-mode: bicubic; display: block;
height: 28px; max-width: 100%; outline: none; text-decoration: none; width:
auto;"
                         height="28">
                </td>
            </tr>
            <tr style="padding: 0; text-align: left; vertical-align: top;">
                <td class=""
                    style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens: auto;
line-height: 19px; margin: 0; padding: 0; text-align: left; vertical-align: top;
word-break: break-word;">
                    <table class="oneProductWithImg"
                           style="border-collapse: collapse; border-spacing: 0;
                  padding: 0; table-layout: fixed; text-align: left;
vertical-align: top; width: 75%;"
                           align="center">
                        <tbody>
                                                    <tr style="padding: 0;
text-align: left; vertical-align: top;">
                                <td colspan="2"
                                    style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens:
auto; line-height: 19px; margin: 0; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;">
                                    <table style="border-collapse: collapse;
border-spacing: 0; height: 23px; padding: 0; text-align: left; vertical-align:
top;">
                                        <tbody>
                                        <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                                                                
                                                                                
              </tr>
                                        </tbody>
                                    </table>
                                </td>
                            </tr>
                            <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                <td class="blocProduct-img"
                                    style="-moz-box-sizing: border-box;
-moz-hyphens: auto; -webkit-box-sizing: border-box; -webkit-hyphens: auto;
border-collapse: collapse; box-sizing: border-box; color: #222222; display:
table-cell; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
14px; font-weight: normal; hyphens: auto; line-height: 15px; margin: 0; padding:
10px; text-align: left; vertical-align: top; width: 30%; word-break:
break-word;">
                                    <img
src="https://static.fnac-static.com/multimedia/Images/A9/9A/56/13/20277673-1505-1502-1.jpg"
width="110"
                                         style="-ms-interpolation-mode: bicubic;
border: none; display: block; height: auto; max-width: 100%; outline: none;
text-decoration: none;">
                                </td>
                                <td class="blocProduct-desc"
                                    style="-moz-box-sizing: border-box;
-moz-hyphens: auto; -webkit-box-sizing: border-box; -webkit-hyphens: auto;
border-collapse: collapse; box-sizing: border-box; color: #222222; display:
table-cell; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
14px; font-weight: normal; hyphens: auto; line-height: 15px; margin: 0; padding:
10px; text-align: left; vertical-align: top; width: 70%; word-break:
break-word;">
                                    <table class="blocProduct-descInside"
                                           style="-moz-box-sizing: border-box;
-webkit-box-sizing: border-box; border-collapse: collapse; border-spacing: 0;
box-sizing: border-box; padding: 0; table-layout: fixed; text-align: left;
vertical-align: top; width: 100%;">
                                        <tbody>
                                        <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                            <td style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 14px; margin: 0; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;">
                                       <span class="product-quantity"
                                             style="color: #f5b027; font-weight:
bold;">1</span>
                                                x <span class="product-title
txtBold"
                                                        style="color: #232323;
font-size: 15px; font-weight: bold;">98642 Calendrier de l&#039;avent horse club
2022</span>
                                                <span class="product-seller"
                                                      style="visibility:
hidden;margin-top:
0px;color:#989898;font-weight:lighter;font-size:0px;line-height:0px;display:block;font-family:'Roboto',
Helvetica, Arial, sans-serif !important">
                                                                                
                           Vendu par GET GOODS
                                                                                
                   </span>
                                            </td>
                                        </tr>
                                        <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                            <td style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 14px; margin: 0; mso-line-height-rule: exactly;
padding: 0; text-align: left; vertical-align: top; word-break: break-word;">
                                                &nbsp;
                                            </td>
                                        </tr>
                                        <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                            <td class="txtBold"
                                                style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 13px; font-weight: bold;
hyphens: auto; line-height: 16px; margin: 0; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;">
                                                <span>Etat du produit</span>
                                                <br>
                                                <span class="txtMustard"
                                                      style="color:
#eab011;">Neuf</span>
                                            </td>
                                        </tr>
                                        <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                            <td style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 14px; margin: 0; mso-line-height-rule: exactly;
padding: 0; text-align: left; vertical-align: top; word-break: break-word;">
                                                &nbsp;
                                            </td>
                                        </tr>
                                        <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                            <td style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 16px; margin: 0; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;">
                                                <table
class="product-priceTable"
                                                       style="border-collapse:
collapse; border-spacing: 0; height: 20px; padding: 0; text-align: left;
vertical-align: top;">
                                                    <tbody>
                                                    <tr style="padding: 0;
text-align: left; vertical-align: top;">
                                                                                
                                   <td class="product-priceTable-integer"
                                                               
style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse: collapse;
color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
20px; font-weight: normal; hyphens: auto; line-height: 20px; margin: 0;
mso-line-height-rule: exactly; padding: 0; text-align: left; vertical-align:
top; word-break: break-word;"
                                                                valign="top">
                                                                                
       
            29&euro;
    
                                                            </td>
                                                            <td
class="product-priceTable-cts"
                                                               
style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse: collapse;
color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
15px; font-weight: normal; hyphens: auto; line-height: 18px; margin: 0;
mso-line-height-rule: exactly; padding: 0; text-align: left; vertical-align:
top; word-break: break-word;"
                                                                valign="top">
                                                                                
                                                                           
            99
    
                                                                                
                                           </td>
                                                                                
                           </tr>
                                                    </tbody>
                                                </table>
                                                <table
class="blocProduct-descInside"
                                                       style="-moz-box-sizing:
border-box;
-webkit-box-sizing: border-box; border-collapse: collapse; border-spacing: 0;
box-sizing: border-box; height: 100%; min-height: 144px; padding: 0;
table-layout: fixed; text-align: left; vertical-align: top; width: 100%;">
                                                    <tbody>
                                                    <tr style="padding: 0;
text-align: left; vertical-align: top;">
                                                        <td style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #CC0000;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 13px;
font-weight: bold; hyphens: auto; line-height: 16px; margin: 0; padding: 0;
text-align: left; vertical-align: top; word-break: break-word;">
                                                            
                                                        </td>
                                                    </tr>
                                                    </tbody>
                                                </table>
                                            </td>
                                        </tr>
                                        <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                            <td style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 14px; margin: 0; mso-line-height-rule: exactly;
padding: 0; text-align: left; vertical-align: top; word-break: break-word;">
                                                &nbsp;
                                            </td>
                                        </tr>
                                        </tbody>
                                    </table>
                                </td>
                            </tr>
                                                </tbody>
                    </table>
                </td>
            </tr>
        </table>
    </td>
</tr>                </tbody>
</table>
<br>
    
                        <table class="container bgWhite"
       style="-moz-box-sizing: border-box; -webkit-box-sizing: border-box;
Margin: 0 auto; background-color: #ffffff; border-collapse: collapse;
border-spacing: 0; box-sizing: border-box; margin: 0 auto; overflow: hidden;
padding: 0; table-layout: fixed; text-align: left; vertical-align: top; width:
660px;">
    <tbody>
        <tr style="padding: 0; text-align: left; vertical-align: top;">
            <td class="payment" style="-moz-hyphens: auto; -webkit-hyphens:
auto; background-color: #ffffff; border-collapse: collapse; color: #999999;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding: 10px
15px; text-align: left; vertical-align: top; word-break: break-word;">
                <table class="payment-table" style="border-collapse: collapse;
border-spacing: 0; padding: 0; table-layout: fixed; text-align: left;
vertical-align: top; width: 100%;">
                    <tbody>
                    
                        <tr style="padding: 0; text-align: left; vertical-align:
top;">
                            <td class="payment-tdKey txtGrey"
style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse: collapse;
color: #777777; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
17px; font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding:
12px 0px 12px 10px; text-align: left; vertical-align: top; width: 49%;
word-break: break-word;">
                                Mode de livraison
                            </td>
                            <td class="txtBold payment-tdValue"
                                style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 17px; font-weight: bold; hyphens: auto;
line-height: 19px; margin: 0; padding: 12px 0px 12px 10px; text-align: right;
vertical-align: top; width: 46%; word-break: break-word;">
                                Suivi
                            </td>
                        </tr>
                                        <tr style="padding: 0; text-align: left;
vertical-align: top;">
                        <td class="paiement-border" colspan="2"
                            style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens: auto;
line-height: 19px; margin: 0; padding: 0; text-align: left; vertical-align: top;
word-break: break-word;">
                            <hr style="background-color: #d9d9d9; border: none;
color: #d9d9d9; height: 1px;">
                        </td>
                    </tr>
                    </tbody>
                </table>
            </td>
        </tr>

                    <tr style="padding: 0; text-align: left; vertical-align:
top;">
                <td class="payment center bgWhite"
                    style="-moz-hyphens: auto; -webkit-hyphens: auto;
background-color: #ffffff; border-collapse: collapse; color: #999999;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding: 10px
15px; text-align: center; vertical-align: top; word-break: break-word;">

                    <table class="warning"
                           style="background-color: #ffffff; border-collapse:
collapse; border-spacing: 0; padding: 0; padding-bottom: 10px; padding-top:
10px; text-align: left; vertical-align: top;">
                        <tbody>
                        <tr style="padding: 0; text-align: left; vertical-align:
top;">
                            <td class="warning-picto--orderConfirmation"
                                style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens:
auto; line-height: 19px; margin: 0; padding: 0; padding-left: 20px;
padding-right: 20px; text-align: left; vertical-align: top; width: 41px;
word-break: break-word;">
                                <img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive/expedition-common/information.gif"
                                     style="-ms-interpolation-mode: bicubic;
display: block; max-width: 100%; outline: none; text-decoration: none; width:
auto;">
                            </td>
                            <td class="warning-txt"
                                style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens:
auto; line-height: 19px; margin: 0; padding: 0; padding-right: 30px; text-align:
left; vertical-align: middle; word-break: break-word;">
                                <span class="txtBold" style="font-weight:
bold;">Si vous avez choisi un mode de livraison avec numÃ©ro de suivi : </span>
                                vous trouverez ce dernier dans un prochain mail,
dÃ¨s que le vendeur l&#039;aura renseignÃ©.
                                <br>
                                <br>
                                <span class="txtBold" style="font-weight:
bold;">Si vous avez choisi une livraison en mode recommandÃ© : </span>
                                nous vous recommandons de dÃ©baller la
marchandise devant le livreur. Si toutefois vous constatiez que le produit est
endommagÃ©, il faut le mentionner impÃ©rativement sur le bordereau de livraison,
faute de quoi, la responsabilitÃ© du livreur ne pourra pas Ãªtre engagÃ©e*.
                                                            </td>
                        </tr>
                        </tbody>
                    </table>
                </td>
            </tr>
        
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="blocButton-mrgB"
            style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse:
collapse; color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif;
font-size: 14px; font-weight: normal; height: 14px; hyphens: auto; line-height:
14px; margin: 0; mso-line-height-rule: exactly; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;">
            &nbsp;
        </td>
    </tr>
    </tbody>
</table>
    <br>
            
    
                        <!-- DEBUT Bloc Paiement -->
<table class="container" style="-moz-box-sizing: border-box; -webkit-box-sizing:
border-box; Margin: 0 auto; border-collapse: collapse; border-spacing: 0;
box-sizing: border-box; margin: 0 auto; overflow: hidden; padding: 0;
table-layout: fixed; text-align: left; vertical-align: top; width: 660px;">
    <tbody>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="title" style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; display: block; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 32px; font-weight: lighter;
hyphens: auto; line-height: 43px; margin: 0; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;">
            Paiement
        </td>
    </tr>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="title-break" style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 8px; font-weight: normal; hyphens:
auto; line-height: 8px; margin: 0; mso-line-height-rule: exactly; padding: 0;
text-align: left; vertical-align: top; word-break: break-word;">&nbsp;</td>
    </tr>
    </tbody>
</table>
<table class="container" style="-moz-box-sizing: border-box; -webkit-box-sizing:
border-box; Margin: 0 auto; border-collapse: collapse; border-spacing: 0;
box-sizing: border-box; margin: 0 auto; overflow: hidden; padding: 0;
table-layout: fixed; text-align: left; vertical-align: top; width: 660px;">
    <tbody>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="payment" style="-moz-hyphens: auto; -webkit-hyphens: auto;
background-color: #ffffff; border-collapse: collapse; color: #999999;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding: 10px
15px; text-align: left; vertical-align: top; word-break: break-word;">

            <table class="payment-table" style="border-collapse: collapse;
border-spacing: 0; padding: 0; table-layout: fixed; text-align: left;
vertical-align: top; width: 100%;">
                <tbody>
                <tr style="padding: 0; text-align: left; vertical-align: top;">
                    <td class="payment-tdKey txtGrey" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #777777; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 17px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 12px 0px 12px 10px;
text-align: left; vertical-align: top; width: 49%; word-break: break-word;">
                        Mode de rÃ¨glement
                    </td>
                    <td class="txtBold payment-tdValue" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 17px;
font-weight: bold; hyphens: auto; line-height: 19px; margin: 0; padding: 12px
0px 12px 10px; text-align: right; vertical-align: top; width: 46%; word-break:
break-word;">
                                                                               
Carte bancaire
                                            </td>
                </tr>
                <tr style="padding: 0; text-align: left; vertical-align: top;">
                    <td class="paiement-border" colspan="2" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding: 0;
text-align: left; vertical-align: top; word-break: break-word;">
                        <hr style="background-color: #d9d9d9; border: none;
color: #d9d9d9; height: 1px;">
                    </td>
                </tr>
                <tr style="padding: 0; text-align: left; vertical-align: top;">
                    <td class="payment-tdKey txtGrey" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #777777; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 17px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 12px 0px 12px 10px;
text-align: left; vertical-align: top; width: 49%; word-break: break-word;">
                        Frais d&#039;expÃ©dition
                    </td>
                    <td class="txtBold payment-tdValue" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 17px;
font-weight: bold; hyphens: auto; line-height: 19px; margin: 0; padding: 12px
0px 12px 10px; text-align: right; vertical-align: top; width: 46%; word-break:
break-word;">

                        <table class="payment-priceTable"
style="border-collapse: collapse; border-spacing: 0; display: inline-table;
height: 20px; padding: 0; text-align: left; vertical-align: top;">
                            <tbody>
                            <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                <td class="payment-priceTable-integer"
style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse: collapse;
color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
18px; font-weight: bold; hyphens: auto; line-height: 18px; margin: 0;
mso-line-height-rule: exactly; padding: 0; text-align: left; vertical-align:
top; word-break: break-word;">
                                    <table class="payment-priceTable"
style="border-collapse: collapse; border-spacing: 0; display: inline-table;
height: 20px; padding: 0; text-align: left; vertical-align: top;">
                                        <tbody>
                                        <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                                                                
           <td class="product-priceTable-integer" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 20px; font-weight: normal;
hyphens: auto; line-height: 20px; margin: 0; mso-line-height-rule: exactly;
padding: 0; text-align: left; vertical-align: top; word-break: break-word;"
valign="top">
                                                                            
            35&euro;
    
                                                </td>
                                                <td
class="product-priceTable-cts" style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 15px; font-weight: normal; hyphens: auto;
line-height: 18px; margin: 0; mso-line-height-rule: exactly; padding: 0;
text-align: left; vertical-align: top; word-break: break-word;" valign="top">
                                                                                
                                                   
            94
    
                                                                                
                   </td>
                                                                                
   </tr>
                                        </tbody>
                                    </table>

                                </td>
                            </tr>
                            </tbody>
                        </table>

                    </td>
                </tr>
                <tr style="padding: 0; text-align: left; vertical-align: top;">
                    <td class="paiement-border" colspan="2" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding: 0;
text-align: left; vertical-align: top; word-break: break-word;">
                        <hr style="background-color: #d9d9d9; border: none;
color: #d9d9d9; height: 1px;">
                    </td>
                </tr>
                <tr style="padding: 0; text-align: left; vertical-align: top;">
                    <td class="payment-tdKey txtGrey" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #777777; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 17px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 12px 0px 12px 10px;
text-align: left; vertical-align: top; width: 49%; word-break: break-word;">
                        Montant total TTC
                    </td>
                    <td class="txtBold payment-tdValue" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 17px;
font-weight: bold; hyphens: auto; line-height: 19px; margin: 0; padding: 12px
0px 12px 10px; text-align: right; vertical-align: top; width: 46%; word-break:
break-word;">
                        <table class="payment-priceTable"
style="border-collapse: collapse; border-spacing: 0; display: inline-table;
height: 20px; padding: 0; text-align: left; vertical-align: top;">
                            <tbody>
                            <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                                                    <td
class="product-priceTable-integer" style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 20px; font-weight: normal; hyphens:
auto; line-height: 20px; margin: 0; mso-line-height-rule: exactly; padding: 0;
text-align: left; vertical-align: top; word-break: break-word;" valign="top">
                                                                
            35&euro;
    
                                    </td>
                                    <td class="product-priceTable-cts"
style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse: collapse;
color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
15px; font-weight: normal; hyphens: auto; line-height: 18px; margin: 0;
mso-line-height-rule: exactly; padding: 0; text-align: left; vertical-align:
top; word-break: break-word;" valign="top">
                                                                                
                           
            94
    
                                                                           
</td>
                                                            </tr>
                            </tbody>
                        </table>
                    </td>

                </tbody>
            </table>

        </td>
    </tr>

    </tbody>
</table>
<br>
<br>
<!-- FIN Bloc Paiement -->            
        
            <table class="bgWhite container"
       style="-moz-box-sizing: border-box; -webkit-box-sizing: border-box;
Margin: 0 auto; background-color: #ffffff; border-collapse: collapse;
border-spacing: 0; box-sizing: border-box; margin: 0 auto; overflow: hidden;
padding: 0; table-layout: fixed; text-align: left; vertical-align: top; width:
660px;">
    <tbody>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="blocMessage"
            style="-moz-hyphens: auto; -webkit-hyphens: auto; background-color:
#ffffff; border-collapse: collapse; box-sizing: border-box; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding: 20px
0; text-align: center; vertical-align: top; width: 100%; word-break:
break-word;">
            <table class="blocMessage-table"
                   style="border-collapse: collapse; border-spacing: 0; padding:
0; table-layout: fixed; text-align: left; vertical-align: top; width: 100%;">
                <tbody>
                <tr style="padding: 0; text-align: left; vertical-align: top;">
                    <td class="center"
                        style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens: auto;
line-height: 19px; margin: 0; padding: 0; text-align: center; vertical-align:
top; word-break: break-word;">
                        <img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive/email_mp/picto-impatient.gif"
                             style="-ms-interpolation-mode: bicubic; display:
inline; height: 82px; max-width: 100%; outline: none; text-decoration: none;
width: 82px;"
                             width="82" height="82">
                        <br>
                                                    <p
class="afterCommandTwoCols-title"
                               style="color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 22px; font-weight: normal; line-height:
19px; margin: 0; margin-top: 14px; padding: 0; text-align: center;">
                                Besoin d&#039;informations ?
                            </p>
                                                                        <p
style="color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif;
font-size: 14px; font-weight: normal; line-height: 19px; margin: 0;
margin-bottom: 0; margin-top: 17px; padding: 0; text-align: center;">Vous
souhaitez entrer en contact avec votre vendeur ?
                            <br>
                            <strong>Suivre votre commande</strong> Ã  la trace ?
                        </p>
                                                <br>
                            <table class="container" style="-moz-box-sizing:
border-box; -webkit-box-sizing: border-box; border-collapse: collapse;
border-spacing: 0; box-sizing: border-box; margin: 0 auto; overflow: hidden;
padding: 0; table-layout: fixed; text-align: left; vertical-align: top; width:
100%;">
    <tbody>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="center" style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens: auto;
line-height: 19px; margin: 0; padding: 0; text-align: center; vertical-align:
top; word-break: break-word;">
                <table class="blocButton-table blocButton-table--mustard"
style="border-collapse: collapse; border-spacing: 0; display: inline-table;
height: 41px; margin: 0 auto; padding: 0; table-layout: fixed; text-align:
center; vertical-align: top;">
                <tbody>
                <tr style="background-color: #f5b027; padding: 0; text-align:
left; vertical-align: top;">
                    <td width="41" class="blocButton-img" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; height: 41px; hyphens: auto; line-height: 19px; margin: 0;
padding: 0; text-align: left; vertical-align: top; width: 41px; word-break:
break-word;">
                        <a href="https://secure.fnac.com/account/order/"
title="DÃ©tails de ma commande" target="_blank" style="display: block; height:
41px; text-decoration: none; width: 41px;"><img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive2016/btn/btn--silver-mustard-left.gif"
width="41" height="41" style="-ms-interpolation-mode: bicubic; border: none;
display: inline; height: 41px; max-width: none; outline: none; text-decoration:
none; width: 41px;"></a>
                    </td>
                    <td class="blocButton-txt" style="-moz-box-sizing:
border-box; -moz-hyphens: auto; -webkit-box-sizing: border-box; -webkit-hyphens:
auto; border-collapse: collapse; box-sizing: border-box; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; height: 41px; hyphens: auto; line-height: 19px; margin: 0;
padding: 0; text-align: center; vertical-align: top; word-break: break-word;">
                        <table class="blocButton-txtTable
blocButton-txtTable--mustard" style="-moz-box-sizing: border-box;
-webkit-box-sizing: border-box; border-collapse: collapse; border-spacing: 0;
box-sizing: border-box; height: 41px; padding: 0; table-layout: fixed;
text-align: left; vertical-align: middle;">
                            <tbody>
                            <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                <td class="blocButton-txtTd"
style="-moz-box-sizing: border-box; -moz-hyphens: auto; -webkit-box-sizing:
border-box; -webkit-hyphens: auto; border-collapse: collapse; box-sizing:
border-box; color: #222224; font-family: 'Roboto', Helvetica, Arial, sans-serif;
font-size: 14px; font-weight: normal; height: 39px; hyphens: auto; line-height:
19px; margin: 0; padding: 0; text-align: center; vertical-align: middle;
word-break: break-word;">
                                    <a class="blocButton-txtLink--mustard "
href="https://secure.fnac.com/account/order/" title="DÃ©tails de ma commande"
target="_blank" style="color: #ffffff; font-size: 19px; font-weight: bold;
text-decoration: none;">
                                        DÃ©tails de ma commande
                                    </a>
                                </td>
                            </tr>
                            </tbody>
                        </table>
                    </td>
                    <td width="41" class="blocButton-img" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; height: 41px; hyphens: auto; line-height: 19px; margin: 0;
padding: 0; text-align: left; vertical-align: top; width: 41px; word-break:
break-word;">
                        <a href="https://secure.fnac.com/account/order/"
title="DÃ©tails de ma commande" target="_blank" style="display: block; height:
41px; text-decoration: none; width: 41px;"><img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive2016/btn/btn--silver-mustard-right.gif"
width="41" height="41" style="-ms-interpolation-mode: bicubic; border: none;
display: inline; height: 41px; max-width: none; outline: none; text-decoration:
none; width: 41px;"></a>
                    </td>
                </tr>
                </tbody>
            </table>
        </td>
    </tr>
    </tbody>
</table>
    
                    </td>
                </tr>
                </tbody>
            </table>
        </td>
    </tr>
    </tbody>
</table>
<br>
    
            <table class="container"
       style="background-color: #232323; -moz-box-sizing: border-box;
-webkit-box-sizing: border-box; Margin: 0 auto; border-collapse: collapse;
border-spacing: 0; box-sizing: border-box; margin: 0 auto; overflow: hidden;
padding: 0; table-layout: fixed; text-align: left; vertical-align: top; width:
660px;">
    <tbody>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="title"
            style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse:
collapse; color: #222222; display: block; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 32px; font-weight: lighter; hyphens: auto;
line-height: 43px; margin: 0; padding: 0; text-align: left; vertical-align: top;
word-break: break-word;">
            Livraison
        </td>
    </tr>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="title-break"
            style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse:
collapse; color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif;
font-size: 8px; font-weight: normal; hyphens: auto; line-height: 8px; margin: 0;
mso-line-height-rule: exactly; padding: 0; text-align: left; vertical-align:
top; word-break: break-word;">
            &nbsp;
        </td>
    </tr>
    </tbody>
</table>
<table class="container"
       style="background-color: #232323; -moz-box-sizing: border-box;
-webkit-box-sizing: border-box; border-collapse: collapse; border-spacing: 0;
box-sizing: border-box; margin: 0 auto; overflow: hidden; padding: 0;
table-layout: fixed; text-align: left; vertical-align: top; width: 660px;"
       cellspacing="0" cellpadding="0" border="0">
    <tbody>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse:
collapse; color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif;
font-size: 14px; font-weight: normal; hyphens: auto; line-height: 19px; margin:
0; padding: 0; text-align: left; vertical-align: top; word-break: break-word;">
            <table class="shippingBilling"
                   style="background-color: #232323; -moz-box-sizing:
border-box; -webkit-box-sizing: border-box; border-collapse: collapse;
border-spacing: 0; box-sizing: border-box; height: auto; padding: 0; margin: 0;
table-layout: fixed; text-align: left; vertical-align: top; width: 100%; border:
none;"
                   cellspacing="0" cellpadding="0" border="0">
                <tbody>
                <tr style="padding: 0; text-align: left; vertical-align: top;">
                    <td class="shippingBilling-col shippingBilling-col--brd"
                        style="-moz-box-sizing: border-box; -moz-hyphens: auto;
-webkit-box-sizing: border-box; -webkit-hyphens: auto; border-collapse:
collapse; box-sizing: border-box; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal; height:
100%; hyphens: auto; line-height: 19px; margin: 0; padding: 20px 0; text-align:
left; vertical-align: top; width: 50%; word-break: break-word;">
                        <table class="shippingBilling-table"
                               style="background-color: #232323;
border-collapse: collapse; border-spacing: 0; padding: 0; margin: 0;
table-layout: fixed; text-align: left; vertical-align: top; width: 100%;"
                               cellspacing="0" cellpadding="0" border="0">
                            <tbody>
                            <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                <td class="shippingBilling-content"
                                    style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens:
auto; line-height: 19px; margin: 0; padding: 0; padding-left: 30px;
padding-right: 30px; text-align: left; vertical-align: top; word-break:
break-word;">
                                    <table class="shippingBilling-contentTable"
                                           style="background-color: #232323;
-moz-box-sizing: border-box; -webkit-box-sizing: border-box; border-collapse:
collapse; border-spacing: 0; box-sizing: border-box; padding: 0; margin: 0;
table-layout: fixed; text-align: left; vertical-align: top; width: 100%; border:
none;"
                                           cellspacing="0" cellpadding="0"
border="0">
                                        <tbody>
                                        <tr style="padding: 0; margin: 0;
text-align: left; vertical-align: top;">
                                            <td
class="shippingBilling-headerPicto"
                                                style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 0; text-align: left;
vertical-align: top; width: 48px; word-break: break-word;"
                                                width="48">
                                                <img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive/expedition-common/shipping-address-yellow.gif"
                                                    
style="-ms-interpolation-mode: bicubic; display: block; max-width: 100%;
outline: none; text-decoration: none; width: auto;"
                                                     width="24" height="31">
                                            </td>
                                            <td
class="shippingBilling-headerTitle"
                                                style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: white; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 25px; font-weight: lighter;
hyphens: auto; line-height: 27px; margin: 0; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;">
                                                                                
                                                               <span
class="txtBold" style="display: block; font-weight: bold; line-height:
21px;">Adresse</span> de livraison
                                            </td>
                                        </tr>
                                        </tbody>
                                    </table>
                                </td>
                            </tr>
                            <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                <td class="shippingBilling-pdg"
                                    style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 20px; font-weight: normal; hyphens:
auto; line-height: 20px; margin: 0; mso-line-height-rule: exactly; padding: 0;
text-align: left; vertical-align: top; word-break: break-word;">
                                    &nbsp;
                                </td>
                            </tr>
                            <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                <td class="shippingBilling-content"
                                    style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens:
auto; line-height: 19px; margin: 0; padding: 0; padding-left: 30px;
padding-right: 30px; text-align: left; vertical-align: top; word-break:
break-word;">
                                    <table class="shippingBilling-contentTable"
                                           style="background-color: #232323;
-moz-box-sizing: border-box; -webkit-box-sizing: border-box; border-collapse:
collapse; border-spacing: 0; box-sizing: border-box; padding: 0; margin: 0;
table-layout: fixed; text-align: left; vertical-align: top; width: 100%;"
                                           cellspacing="0" cellpadding="0"
border="0">
                                        <tbody>
                                        <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                            <td
class="shippingBilling-headerPicto"
                                                style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 0; text-align: left;
vertical-align: top; width: 48px; word-break: break-word;"
                                                width="48">&nbsp;
                                            </td>
                                            <td class="shippingBilling-details"
                                                style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;">
                                                <p class="txtBold"
                                                   style="color: white;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: bold; line-height: 22px; margin: 0; padding: 0; text-align: left;">
                                                    KARINE LACAZE
                                                </p>
                                                <p style="color: white;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; line-height: 22px; margin: 0; padding: 0; text-align:
left;">
                                                    3 COTE DE DEZE
                                                    
                                                    
                                                </p>
                                                <p style="color: white;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; line-height: 22px; margin: 0; padding: 0; text-align:
left;">
                                                    15600 SAINT ETIENNE DE MAURS
                                                </p>
                                                <p style="color: white;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; line-height: 22px; margin: 0; padding: 0; text-align:
left;">
                                                    FRA
                                                </p>
                                            </td>
                                        </tr>
                                        </tbody>
                                    </table>
                                </td>
                            </tr>
                            </tbody>
                        </table>
                    </td>
                                        <td class="shippingBilling-col"
                        style="-moz-box-sizing: border-box; -moz-hyphens: auto;
-webkit-box-sizing: border-box; -webkit-hyphens: auto; border-collapse:
collapse; box-sizing: border-box; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal; height:
100%; hyphens: auto; line-height: 19px; margin: 0; padding: 20px 0; text-align:
left; vertical-align: top; width: 50%; word-break: break-word;">
                        <table class="shippingBilling-table"
                               style="background-color: #232323;
border-collapse: collapse; border-spacing: 0; padding: 0; margin: 0;
table-layout: fixed; text-align: left; vertical-align: top; width: 100%;"
                               cellspacing="0" cellpadding="0" border="0">
                            <tbody>
                            <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                <td class="shippingBilling-content"
                                    style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens:
auto; line-height: 19px; margin: 0; padding: 0; padding-left: 30px;
padding-right: 30px; text-align: left; vertical-align: top; word-break:
break-word;">
                                    <table class="shippingBilling-contentTable"
                                           style="background-color: #232323;
-moz-box-sizing: border-box; -webkit-box-sizing: border-box; border-collapse:
collapse; border-spacing: 0; box-sizing: border-box; padding: 0; margin: 0;
table-layout: fixed; text-align: left; vertical-align: top; width: 100%;"
                                           cellspacing="0" cellpadding="0"
border="0">
                                        <tbody>
                                        <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                            <td
class="shippingBilling-headerPicto"
                                                style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 0; text-align: left;
vertical-align: top; width: 48px; word-break: break-word;"
                                                width="48">
                                                <img
class="shippingBilling-headerPicto--billing"
                                                    
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive/expedition-common/billing.png"
                                                    
style="-ms-interpolation-mode: bicubic; display: block; max-width: 100%;
outline: none; text-decoration: none; width: auto;"
                                                     width="36" height="28">
                                            </td>
                                            <td
class="shippingBilling-headerTitle"
                                                style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: white; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 25px; font-weight: lighter;
hyphens: auto; line-height: 27px; margin: 0; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;">
                                                                                
                                                                           <span
class="txtBold" style="display: block; font-weight: bold; line-height:
21px;">Adresse</span> de facturation
                                            </td>
                                        </tr>
                                        </tbody>
                                    </table>
                                </td>
                            </tr>
                            <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                <td class="shippingBilling-pdg"
                                    style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 20px; font-weight: normal; hyphens:
auto; line-height: 20px; margin: 0; mso-line-height-rule: exactly; padding: 0;
text-align: left; vertical-align: top; word-break: break-word;">
                                    &nbsp;
                                </td>
                            </tr>
                            <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                <td class="shippingBilling-content"
                                    style="-moz-hyphens: auto; -webkit-hyphens:
auto; border-collapse: collapse; color: #222222; font-family: 'Roboto',
Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens:
auto; line-height: 19px; margin: 0; padding: 0; padding-left: 30px;
padding-right: 30px; text-align: left; vertical-align: top; word-break:
break-word;">
                                    <table class="shippingBilling-contentTable"
                                           style="background-color: #232323;
-moz-box-sizing: border-box; -webkit-box-sizing: border-box; border-collapse:
collapse; border-spacing: 0; box-sizing: border-box; padding: 0; margin: 0;
table-layout: fixed; text-align: left; vertical-align: top; width: 100%;"
                                           cellspacing="0" cellpadding="0"
border="0">
                                        <tbody>
                                        <tr style="padding: 0; text-align: left;
vertical-align: top;">
                                            <td
class="shippingBilling-headerPicto"
                                                style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 0; text-align: left;
vertical-align: top; width: 48px; word-break: break-word;"
                                                width="48">&nbsp;
                                            </td>
                                            <td class="shippingBilling-details"
                                                style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;">
                                                <p class="txtBold"
                                                   style="color: white;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: bold; line-height: 22px; margin: 0; padding: 0; text-align: left;">
                                                    KARINE LACAZE
                                                </p>
                                                <p style="color: white;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; line-height: 22px; margin: 0; padding: 0; text-align:
left;">
                                                    3 COTE DE DEZE
                                                    
                                                    
                                                </p>
                                                <p style="color: white;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; line-height: 22px; margin: 0; padding: 0; text-align:
left;">
                                                    15600 SAINT ETIENNE DE MAURS
                                                </p>
                                                <p style="color: white;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; line-height: 22px; margin: 0; padding: 0; text-align:
left;">
                                                    FRA
                                                </p>
                                            </td>
                                        </tr>
                                        </tbody>
                                    </table>
                                </td>
                            </tr>
                            </tbody>
                        </table>
                    </td>
                                    </tr>
                </tbody>
            </table>
        </td>
    </tr>
    </tbody>
</table>
<br>
<br>

    
                    
                    

            <table class="footerServiceClient" style="background: #ffffff;
background-color: #ffffff; border-collapse: collapse; border-spacing: 0;
padding: 0; table-layout: fixed; text-align: left; vertical-align: top; width:
100%;">
  <tbody>
  <tr style="padding: 0; text-align: left; vertical-align: top;">
    <td class="footerServiceClient-padding" height="20" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 20px;
font-weight: normal; hyphens: auto; line-height: 20px; margin: 0;
mso-line-height-rule: exactly; padding: 0; text-align: left; vertical-align:
top; word-break: break-word;">&nbsp;</td>
  </tr>
  <tr style="padding: 0; text-align: left; vertical-align: top;">
    <td align="center" class="center" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 0; text-align: center;
vertical-align: top; word-break: break-word;">

      <table class="container" style="-moz-box-sizing: border-box;
-webkit-box-sizing: border-box; Margin: 0 auto; border-collapse: collapse;
border-spacing: 0; box-sizing: border-box; margin: 0 auto; overflow: hidden;
padding: 0; table-layout: fixed; text-align: left; vertical-align: top; width:
660px;">
        <tbody>
        <tr class="footerServiceClient-line" style="padding: 0; text-align:
left; vertical-align: top;">
          <td class="footerServiceClient-container" align="right"
style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse: collapse;
color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
14px; font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding:
0 50px; text-align: center; vertical-align: top; word-break: break-word;">

            <table class="footerServiceClient-table" align="right"
style="border-collapse: collapse; border-spacing: 0; padding: 0; table-layout:
fixed; text-align: left; vertical-align: top; width: 100%;">
              <tr>
              <td class="footerServiceClient-txt" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; display:
table-cell; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
13px; font-weight: normal; hyphens: auto; line-height: 16px; margin: 0; padding:
0 10px; text-align: right; vertical-align: middle; word-break: break-word;">
                                                                    <a
href="https://www.fnac.com/Contact?fromNodeId=0" style="color: #232323;
text-decoration: none;">
                                            ET SI VOUS AVEZ BESOIN D'AIDE, UNE
QUESTION, N'IMPORTE QUOI, <BR> CONTACTEZ <SPAN CLASS="TXTBOLD TXTYELLOW"
STYLE="COLOR: #F1C600; FONT-WEIGHT: BOLD;">NOTRE AIDE EN LIGNE</SPAN>
                </a>
              </td>
              <td class="footerServiceClient-img" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; box-sizing: border-box; color:
#222222; display: table-cell; font-family: 'Roboto', Helvetica, Arial,
sans-serif; font-size: 14px; font-weight: normal; hyphens: auto; line-height:
19px; margin: 0; padding: 0 10px; text-align: left; vertical-align: middle;
width: 44px; word-break: break-word;">
                <img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive/expedition-common/puceFondBlanc.gif"
width="24" height="24" style="-ms-interpolation-mode: bicubic; display: block;
max-width: 100%; outline: none; text-decoration: none; width: auto;">
              </td>
              </tr>
            </table>
          </td>
        </tr>
        </tbody>
      </table>

    </td>
  </tr>
  <tr style="padding: 0; text-align: left; vertical-align: top;">
    <td class="footerServiceClient-padding" height="20" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 20px;
font-weight: normal; hyphens: auto; line-height: 20px; margin: 0;
mso-line-height-rule: exactly; padding: 0; text-align: left; vertical-align:
top; word-break: break-word;">&nbsp;</td>
  </tr>
  </tbody>
</table>


    
                        <table class="footerMore" style="background: #232323;
background-color: #232323; border-collapse: collapse; border-spacing: 0;
padding: 0; position: relative; text-align: left; vertical-align: top; width:
100%;">
  <tbody>
  <tr style="padding: 0; text-align: left; vertical-align: top;">
    <td class="center" style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #222222; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 14px; font-weight: normal; hyphens: auto;
line-height: 19px; margin: 0; padding: 0; text-align: center; vertical-align:
top; word-break: break-word;">
      <table class="container" style="-moz-box-sizing: border-box;
-webkit-box-sizing: border-box; Margin: 0 auto; border-collapse: collapse;
border-spacing: 0; box-sizing: border-box; margin: 0 auto; overflow: hidden;
padding: 0; table-layout: fixed; text-align: left; vertical-align: top; width:
660px;">
        <tbody>
        <tr style="padding: 0; text-align: left; vertical-align: top;">
          <td style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse:
collapse; color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif;
font-size: 14px; font-weight: normal; hyphens: auto; line-height: 19px; margin:
0; padding: 0; text-align: left; vertical-align: top; word-break: break-word;">
            <table class="footerMore-table" style="border-collapse: collapse;
border-spacing: 0; padding: 0; table-layout: fixed; text-align: left;
vertical-align: top; width: 100%;">
              <tbody>
              <tr style="padding: 0; text-align: left; vertical-align: top;">
                <td class="footerMore-apps" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;" width="419">
                  <table class="footerMore-apps-table" style="border-collapse:
collapse; border-spacing: 0; padding: 0; text-align: left; vertical-align:
top;">
                    <tbody>
                    <tr style="padding: 0; text-align: left; vertical-align:
top;">
                      <td class="footerMore-apps-title" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding: 0;
text-align: left; vertical-align: top; width: 100px; word-break: break-word;"
width="100">
                      </td>
                      <td class="footerMore-apps-pdg" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 0 6px; text-align: left;
vertical-align: top; word-break: break-word;">
                        <table class="footerMore-apps-pictoIos"
style="border-collapse: collapse; border-spacing: 0; padding: 0; table-layout:
fixed; text-align: left; vertical-align: top; width: 94px;">
                          <tbody>
                          <tr style="padding: 0; text-align: left;
vertical-align: top;">
                            <td class="footerMore-apps-picto"
style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse: collapse;
color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
14px; font-weight: normal; height: 68px; hyphens: auto; line-height: 19px;
margin: 0; padding: 0; text-align: left; vertical-align: middle; word-break:
break-word;" width="94" valign="middle">
                              <a
href="https://itunes.apple.com/fr/app/fnac/id377379474" target="_blank"
title="Application sur App Store" style="text-decoration: none;">
                                <img class="footerMore-img"
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive2016/footerMore-appStore.png"
style="-ms-interpolation-mode: bicubic; border: none; display: block; max-width:
100%; outline: none; text-decoration: none; width: auto;" width="94" border="0"
height="68">
                              </a>
                            </td>
                          </tr>
                          </tbody>
                        </table>
                      </td>
                      <td class="footerMore-apps-pdg" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 0 6px; text-align: left;
vertical-align: top; word-break: break-word;">
                        <table class="footerMore-apps-pictoAndroid"
style="border-collapse: collapse; border-spacing: 0; padding: 0; table-layout:
fixed; text-align: left; vertical-align: top; width: 96px;">
                          <tbody>
                          <tr style="padding: 0; text-align: left;
vertical-align: top;">
                            <td class="footerMore-apps-picto"
style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse: collapse;
color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
14px; font-weight: normal; height: 68px; hyphens: auto; line-height: 19px;
margin: 0; padding: 0; text-align: left; vertical-align: middle; word-break:
break-word;" width="96" valign="middle">
                              <a
href="https://play.google.com/store/apps/details?id=fr.fnac.com" target="_blank"
title="Application sur Google play" style="text-decoration: none;">
                                <img class="footerMore-img"
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive2016/footerMore-googlePlay.png"
style="-ms-interpolation-mode: bicubic; border: none; display: block; max-width:
100%; outline: none; text-decoration: none; width: auto;" width="94" border="0"
height="68">
                              </a>
                            </td>
                          </tr>
                          </tbody>
                        </table>
                      </td>
                    </tr>
                    </tbody>
                  </table>
                </td>
                <td class="footerMore-commmunity" style="-moz-hyphens: auto;
-webkit-hyphens: auto; border-collapse: collapse; color: #222222; font-family:
'Roboto', Helvetica, Arial, sans-serif; font-size: 14px; font-weight: normal;
hyphens: auto; line-height: 19px; margin: 0; padding: 0; text-align: left;
vertical-align: top; word-break: break-word;">
                  <table class="footerMore-commmunity-table"
style="border-collapse: collapse; border-spacing: 0; padding: 0; text-align:
left; vertical-align: top;" height="68">
                    <tbody>
                    <tr style="padding: 0; text-align: left; vertical-align:
top;">
                      <td class="footerMore-brd" style="-moz-hyphens: auto;
-webkit-hyphens: auto; background-color: #ebebeb; border-collapse: collapse;
color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
1px; font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding:
0; text-align: left; vertical-align: top; width: 1px; word-break: break-word;">
                        &nbsp;
                      </td>
                      <td class="footerMore-commmunity-td" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; height: 68px; hyphens: auto; line-height: 19px; margin: 0;
padding: 0; text-align: left; vertical-align: middle; word-break: break-word;"
width="59">
                        <a href="https://www.facebook.com/Fnac" target="_blank"
title="Facebook" style="text-decoration: none;">
                          <img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive2016/footerMore-facebook.png"
style="-ms-interpolation-mode: bicubic; border: none; display: block; max-width:
100%; outline: none; text-decoration: none; width: auto;" width="59" border="0"
height="68">
                        </a>
                      </td>
                      <td class="footerMore-brd" style="-moz-hyphens: auto;
-webkit-hyphens: auto; background-color: #ebebeb; border-collapse: collapse;
color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
1px; font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding:
0; text-align: left; vertical-align: top; width: 1px; word-break: break-word;">
                        &nbsp;
                      </td>
                      <td class="footerMore-commmunity-td" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; height: 68px; hyphens: auto; line-height: 19px; margin: 0;
padding: 0; text-align: left; vertical-align: middle; word-break: break-word;"
width="59">
                        <a href="https://twitter.com/fnac" target="_blank"
title="Twitter" style="text-decoration: none;">
                          <img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive2016/footerMore-twitter.png"
style="-ms-interpolation-mode: bicubic; border: none; display: block; max-width:
100%; outline: none; text-decoration: none; width: auto;" width="59" border="0"
height="68">
                        </a>
                      </td>
                      <td class="footerMore-brd" style="-moz-hyphens: auto;
-webkit-hyphens: auto; background-color: #ebebeb; border-collapse: collapse;
color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
1px; font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding:
0; text-align: left; vertical-align: top; width: 1px; word-break: break-word;">
                        &nbsp;
                      </td>
                      <td class="footerMore-commmunity-td" style="-moz-hyphens:
auto; -webkit-hyphens: auto; border-collapse: collapse; color: #222222;
font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size: 14px;
font-weight: normal; height: 68px; hyphens: auto; line-height: 19px; margin: 0;
padding: 0; text-align: left; vertical-align: middle; word-break: break-word;"
width="59">
                        <a class="footer-apps-link"
href="https://www.youtube.com/user/fnac" target="_blank" title="Youtube"
style="text-decoration: none;">
                          <img
src="https://static.fnac-static.com/multimedia/fnacdirect/Neolane/responsive2016/footerMore-youtube.png"
style="-ms-interpolation-mode: bicubic; border: none; display: block; max-width:
100%; outline: none; text-decoration: none; width: auto;" width="59" border="0"
height="68">
                        </a>
                      </td>
                      <td class="footerMore-brd" style="-moz-hyphens: auto;
-webkit-hyphens: auto; background-color: #ebebeb; border-collapse: collapse;
color: #222222; font-family: 'Roboto', Helvetica, Arial, sans-serif; font-size:
1px; font-weight: normal; hyphens: auto; line-height: 19px; margin: 0; padding:
0; text-align: left; vertical-align: top; width: 1px; word-break: break-word;">
                        &nbsp;
                      </td>
                    </tr>
                    </tbody>
                  </table>
                </td>
              </tr>
              </tbody>
            </table>
          </td>
        </tr>
        </tbody>
      </table>
    </td>
  </tr>
  </tbody>
</table>            

                        <br>
<table class="container"
       style="-moz-box-sizing: border-box; -webkit-box-sizing: border-box;
Margin: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizing:
border-box; margin: 0 auto; overflow: hidden; padding: 0; table-layout: fixed;
text-align: left; vertical-align: top; width: 660px;">
    <tbody>
    <tr style="padding: 0; text-align: left; vertical-align: top;">
        <td class="footerMentions"
            style="-moz-hyphens: auto; -webkit-hyphens: auto; border-collapse:
collapse; color: #777777; font-family: 'Roboto', Helvetica, Arial, sans-serif;
font-size: 12px; font-weight: normal; hyphens: auto; line-height: 19px; margin:
0; padding: 0 20px; text-align: left; vertical-align: top; word-break:
break-word;">
            Afin de sÃ©curiser les paiements et les livraisons, votre commande
est soumise Ã  un contrÃ´le.
            <br>
            Ces vÃ©rifications sont suceptibles d&#039;entraÃ®ner une
inscription des donnÃ©es de votre compte dans notre fichier d&#039;alerte, ce
qui aura pour effet de dÃ©clencher de nouvelles vÃ©rifications lors de vos
prochaines commandes.<br>
                        Si vous souhaitez prÃ©senter vos observations <a
href="http://www4.fnac.com/Contact" style="color: #292929; text-decoration:
underline;" target="_blank">contactez-nous ici</a>
        </td>
    </tr>
    </tbody>
</table>
<br>
    <table class="container"
           style="-moz-box-sizing: border-box; -webkit-box-sizing: border-box;
Margin: 0 auto; border-collapse: collapse; border-spacing: 0; box-sizing:
border-box; margin: 0 auto; overflow: hidden; padding: 0; table-layout: fixed;
text-align: left; vertical-align: top; width: 660px;">
        <tbody>
        <tr style="padding: 0; text-align: left; vertical-align: top;">
            <td class="footerMentions"
                style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #777777; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 12px; font-weight: normal; hyphens: auto;
line-height: 19px; margin: 0; padding: 0 20px; text-align: left; vertical-align:
top; word-break: break-word;">
                                Pour exercer vos droits conformÃ©ment Ã  la loi
Informatique et LibertÃ©s, ou en savoir plus sur la prÃ©vention des fraudes,
consultez notre page <a href="https://www.fnac.com/Help/donneesPersonnelles"
target="_blank" style="color: #292929; text-decoration: underline;">Informatique
et LibertÃ©s</a>.
            </td>
        </tr>
        </tbody>
    </table>
            <br>
        <table class="container"
               style="-moz-box-sizing: border-box; -webkit-box-sizing:
border-box; border-collapse: collapse; border-spacing: 0; box-sizing:
border-box; margin: 0 auto; overflow: hidden; padding: 0; table-layout: fixed;
text-align: left; vertical-align: top; width: 660px;">
            <tbody>
            <tr style="padding: 0; text-align: left; vertical-align: top;">
                <td class="footerMentions"
                    style="-moz-hyphens: auto; -webkit-hyphens: auto;
border-collapse: collapse; color: #777777; font-family: 'Roboto', Helvetica,
Arial, sans-serif; font-size: 12px; font-weight: normal; hyphens: auto;
line-height: 19px; margin: 0; padding: 0 20px; text-align: left; vertical-align:
top; word-break: break-word;">
                    * Tout risque de perte ou d&#039;endommagement des biens est
transfÃ©rÃ© au consommateur au moment oÃ¹ ce dernier ou un tiers dÃ©signÃ© par
lui, et autre que le transporteur proposÃ© par le professionnel, prend
physiquement possession de ces biens. Â» Article L. 216-4 (code de la
consommation)<br />
                    <br />
                </td>
            </tr>
            </tbody>
        </table>
                

                </center>
            </td>
        </tr>
        </tbody>
    </table>
</div>

</html>
2ÞÿÏÝ^      iéâUiéâUIjÐžÿÿÿÿ   a    ~49f85b7a,:imap://marc.malroux%40orange.fr@imap.orange.fr:993/fetch%3EUID%3E/INBOX/TRASH%3E238649 security-info FnhllAKWRHGAlo+ESXykKAAAAAAAAAAAwAAAAAAAAEaphjojH6pBabDSgSnsfLHeAAAAAgAAAAAAAAAAAAAAAAAAAAEAOQFmCjImkVxP+7sgiYWmMt8FvcOXmlQiTNWFiWlrbpbqgwAAAAAAAAczMIIHLzCCBhegAwIBAgIQBclsKZMO8zxOPkkVwanUCzANBgkqhkiG9w0BAQsFADBZMQswCQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMTMwMQYDVQQDEypEaWdpQ2VydCBHbG9iYWwgRzIgVExTIFJTQSBTSEEyNTYgMjAyMCBDQTEwHhcNMjUwOTEzMDAwMDAwWhcNMjYwOTE1MjM1OTU5WjBYMQswCQYDVQQGEwJGUjEcMBoGA1UEBxMTSVNTWSBMRVMgTU9VTElORUFVWDESMBAGA1UEChMJT3JhbmdlIFNBMRcwFQYDVQQDEw5pbWFwLm9yYW5nZS5mcjCCASIwDQYJKoZIhvcNAQEBBQADggEPADCCAQoCggEBANNuk+RG9+cacpZd+/r1NuDEMsruxHcqH8DIfeEHXTJiisMyJXgeHPgKI4rc3+mv1bhDUAa5ai09LYFgfimd+1Ua2q7E/0jD0u9vm6eo3Jtyna2zPr8xNs7MxFBKBjpaJEUsdfBrtV3CCRnotL1MYO5kUMD+z6UubQ+adXkqRGSFg7EeOmgxtFGgiwV4im78EnxHN2XVSaw8pFRvtquC2hUIZEgrt7vdYYmKsrwHv0fhDFbD1ss9/fD4qQUNmm8bzMWOnV31utNgPlN1WeFWU2fXxUSKP9HPwQZoNXVhiH/LOi3YHHtte5L0fQuo6jvrtqfI2tbSndrjEZboYhKh4IcCAwEAAaOCA/IwggPuMB8GA1UdIwQYMBaAFHSFgMBmx9833s+9KTeqAx2+7c0XMB0GA1UdDgQWBBQrJSpubphCzigM0LK45MCCwb9UOzCBgwYDVR0RBHwweoIOaW1hcC5vcmFuZ2UuZnKCD2ltYXA0Lm9yYW5nZS5mcoIPaW1hcC53YW5hZG9vLmZygg1wb3Aub3JhbmdlLmZygg5wb3Aud2FuYWRvby5mcoIOcG9wMy5vcmFuZ2UuZnKCF3BvcC5tYWlsc2FudGUub3JhbmdlLmZyMD4GA1UdIAQ3MDUwMwYGZ4EMAQICMCkwJwYIKwYBBQUHAgEWG2h0dHA6Ly93d3cuZGlnaWNlcnQuY29tL0NQUzAOBgNVHQ8BAf8EBAMCBaAwHQYDVR0lBBYwFAYIKwYBBQUHAwEGCCsGAQUFBwMCMIGfBgNVHR8EgZcwgZQwSKBGoESGQmh0dHA6Ly9jcmwzLmRpZ2ljZXJ0LmNvbS9EaWdpQ2VydEdsb2JhbEcyVExTUlNBU0hBMjU2MjAyMENBMS0xLmNybDBIoEagRIZCaHR0cDovL2NybDQuZGlnaWNlcnQuY29tL0RpZ2lDZXJ0R2xvYmFsRzJUTFNSU0FTSEEyNTYyMDIwQ0ExLTEuY3JsMIGHBggrBgEFBQcBAQR7MHkwJAYIKwYBBQUHMAGGGGh0dHA6Ly9vY3NwLmRpZ2ljZXJ0LmNvbTBRBggrBgEFBQcwAoZFaHR0cDovL2NhY2VydHMuZGlnaWNlcnQuY29tL0RpZ2lDZXJ0R2xvYmFsRzJUTFNSU0FTSEEyNTYyMDIwQ0ExLTEuY3J0MAwGA1UdEwEB/wQCMAAwggF7BgorBgEEAdZ5AgQCBIIBawSCAWcBZQB1ANgJVTuUT3r/yBYZb5RPhauw+Pxeh1UmDxXRLnK7RUsUAAABmUNwVGYAAAQDAEYwRAIgLyIiiEn+3O0wurWsrU9OnZ0LZiN8AwXd94b8VjEhMeYCIFmPYd5L8xzFwapyvpeBzOG0VZeiabDLGkb4S+SAM2n9AHUAwjF+V0UZo0XufzjespBB68fCIVoiv3/Vta12mtkOUs0AAAGZQ3BUaAAABAMARjBEAiBm2ZlIATBlLlx/6QvZJ3cIHUJQMpUyQs7VcTOwu87rvwIgVdU4d97bZf/YFZAAp4iV4vomjWnEbYCD3KQNHnRHr6EAdQCUTkOH+uzB74HzGSQmqBhlAcfTXzgCAT9yZ31VNy4Z2AAAAZlDcFSAAAAEAwBGMEQCIB6LrXlAfOAPWkZFTkepLl4EEyvKm4pmpEQDVDCpblx+AiB02/ymEJIdmf44WnLwUHCT+CaP95eo3SUAXaOR77vtODANBgkqhkiG9w0BAQsFAAOCAQEAuC7Hw6ujCk1dlLvBtWGwGb9u7Ig4zPtHp6swoqe9UCL1/IkJhg/zjWodELc2/qVPZ6FD/ck+y/0JrTJYp0OOj4W5P/PyLsD1lhEO9dninVjgmrBgyzrSIKChQQfADOtOJPJOt2ltSKD3sRygzpEkX+EcMXNPIG4LY+KVtQX45/98SUZCJs/gP+QZ04/xeFqIwvjITdnXI4l+hTE1VAoyMcaUYPbTdSiKERrEBjR1z1HTVBDrtKNBzButfU12mBIP0/dQJux6MhQPu1QP9jcjKG72ITUpB4uZIUb2UWQj3hjH3XLfHT2YP8LQA7lpmkAOdZUdVZCWx8AY8p2BwydAGBMBAAQAAAAAAAEBAAAFAAAABFAyNTYAAAAOUlNBLVBTUy1TSEEyNTYAA2YKMiaRXE/7uyCJhaYy3wW9w5eaVCJM1YWJaWtuluqDAAAAAAAABzMwggcvMIIGF6ADAgECAhAFyWwpkw7zPE4+SRXBqdQLMA0GCSqGSIb3DQEBCwUAMFkxCzAJBgNVBAYTAlVTMRUwEwYDVQQKEwxEaWdpQ2VydCBJbmMxMzAxBgNVBAMTKkRpZ2lDZXJ0IEdsb2JhbCBHMiBUTFMgUlNBIFNIQTI1NiAyMDIwIENBMTAeFw0yNTA5MTMwMDAwMDBaFw0yNjA5MTUyMzU5NTlaMFgxCzAJBgNVBAYTAkZSMRwwGgYDVQQHExNJU1NZIExFUyBNT1VMSU5FQVVYMRIwEAYDVQQKEwlPcmFuZ2UgU0ExFzAVBgNVBAMTDmltYXAub3JhbmdlLmZyMIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEA026T5Eb35xpyll37+vU24MQyyu7EdyofwMh94QddMmKKwzIleB4c+Aojitzf6a/VuENQBrlqLT0tgWB+KZ37VRrarsT/SMPS72+bp6jcm3KdrbM+vzE2zszEUEoGOlokRSx18Gu1XcIJGei0vUxg7mRQwP7PpS5tD5p1eSpEZIWDsR46aDG0UaCLBXiKbvwSfEc3ZdVJrDykVG+2q4LaFQhkSCu3u91hiYqyvAe/R+EMVsPWyz398PipBQ2abxvMxY6dXfW602A+U3VZ4VZTZ9fFRIo/0c/BBmg1dWGIf8s6Ldgce217kvR9C6jqO+u2p8ja1tKd2uMRluhiEqHghwIDAQABo4ID8jCCA+4wHwYDVR0jBBgwFoAUdIWAwGbH3zfez70pN6oDHb7tzRcwHQYDVR0OBBYEFCslKm5umELOKAzQsrjkwILBv1Q7MIGDBgNVHREEfDB6gg5pbWFwLm9yYW5nZS5mcoIPaW1hcDQub3JhbmdlLmZygg9pbWFwLndhbmFkb28uZnKCDXBvcC5vcmFuZ2UuZnKCDnBvcC53YW5hZG9vLmZygg5wb3AzLm9yYW5nZS5mcoIXcG9wLm1haWxzYW50ZS5vcmFuZ2UuZnIwPgYDVR0gBDcwNTAzBgZngQwBAgIwKTAnBggrBgEFBQcCARYbaHR0cDovL3d3dy5kaWdpY2VydC5jb20vQ1BTMA4GA1UdDwEB/wQEAwIFoDAdBgNVHSUEFjAUBggrBgEFBQcDAQYIKwYBBQUHAwIwgZ8GA1UdHwSBlzCBlDBIoEagRIZCaHR0cDovL2NybDMuZGlnaWNlcnQuY29tL0RpZ2lDZXJ0R2xvYmFsRzJUTFNSU0FTSEEyNTYyMDIwQ0ExLTEuY3JsMEigRqBEhkJodHRwOi8vY3JsNC5kaWdpY2VydC5jb20vRGlnaUNlcnRHbG9iYWxHMlRMU1JTQVNIQTI1NjIwMjBDQTEtMS5jcmwwgYcGCCsGAQUFBwEBBHsweTAkBggrBgEFBQcwAYYYaHR0cDovL29jc3AuZGlnaWNlcnQuY29tMFEGCCsGAQUFBzAChkVodHRwOi8vY2FjZXJ0cy5kaWdpY2VydC5jb20vRGlnaUNlcnRHbG9iYWxHMlRMU1JTQVNIQTI1NjIwMjBDQTEtMS5jcnQwDAYDVR0TAQH/BAIwADCCAXsGCisGAQQB1nkCBAIEggFrBIIBZwFlAHUA2AlVO5RPev/IFhlvlE+Fq7D4/F6HVSYPFdEucrtFSxQAAAGZQ3BUZgAABAMARjBEAiAvIiKISf7c7TC6taytT06dnQtmI3wDBd33hvxWMSEx5gIgWY9h3kvzHMXBqnK+l4HM4bRVl6JpsMsaRvhL5IAzaf0AdQDCMX5XRRmjRe5/ON6ykEHrx8IhWiK/f9W1rXaa2Q5SzQAAAZlDcFRoAAAEAwBGMEQCIGbZmUgBMGUuXH/pC9kndwgdQlAylTJCztVxM7C7zuu/AiBV1Th33ttl/9gVkACniJXi+iaNacRtgIPcpA0edEevoQB1AJROQ4f67MHvgfMZJCaoGGUBx9NfOAIBP3JnfVU3LhnYAAABmUNwVIAAAAQDAEYwRAIgHouteUB84A9aRkVOR6kuXgQTK8qbimakRANUMKluXH4CIHTb/KYQkh2Z/jhacvBQcJP4Jo/3l6jdJQBdo5Hvu+04MA0GCSqGSIb3DQEBCwUAA4IBAQC4LsfDq6MKTV2Uu8G1YbAZv27siDjM+0enqzCip71QIvX8iQmGD/ONah0Qtzb+pU9noUP9yT7L/QmtMlinQ46Phbk/8/IuwPWWEQ712eKdWOCasGDLOtIgoKFBB8AM604k8k63aW1IoPexHKDOkSRf4Rwxc08gbgtj4pW1Bfjn/3xJRkImz+A/5BnTj/F4WojC+MhN2dcjiX6FMTVUCjIxxpRg9tN1KIoRGsQGNHXPUdNUEOu0o0HMG619TXaYEg/T91Am7HoyFA+7VA/2NyMobvYhNSkHi5khRvZRZCPeGMfdct8dPZg/wtADuWmaQA51lR1VkJbHwBjynYHDJ0AYZgoyJpFcT/u7IImFpjLfBb3Dl5pUIkzVhYlpa26W6oMAAAAAAAAE+DCCBPQwggPcoAMCAQICEAhflMAthXvozBT/U+2iPiowDQYJKoZIhvcNAQELBQAwYTELMAkGA1UEBhMCVVMxFTATBgNVBAoTDERpZ2lDZXJ0IEluYzEZMBcGA1UECxMQd3d3LmRpZ2ljZXJ0LmNvbTEgMB4GA1UEAxMXRGlnaUNlcnQgR2xvYmFsIFJvb3QgRzIwHhcNMjAwOTI0MDAwMDAwWhcNMzAwOTIzMjM1OTU5WjBZMQswCQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMTMwMQYDVQQDEypEaWdpQ2VydCBHbG9iYWwgRzIgVExTIFJTQSBTSEEyNTYgMjAyMCBDQTEwggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQDM9xBiT6a7Y2/tkFJWxW0ne3oSVorx9PnW5+GPvZWr8mBBFXDbEgD6Jwq1VzhbfbJRk3GVDmpBlFs1G/p7+rvFviQw/lbvxPN9l+MU9RRNy6cQ8hbqqyLwMSIRYWmQJrp42Zcf431mq3VElXPIrP/vXQqKWUPhrLI6D/NI/NdrN8Fj3N5G1ttF/n0j/ZDoUQceUaNf7UlGVH8siMX0E5yXFTwD6KE53GkMMsGvFldMlEdCfKLInH3m1E1Ur0KZqMEEwnec1kjkzhHgKoCZ8ENwzz92a9FMSaskXsINgv1GqKtsk8xiUkJ1kvia+l5esrBh5R8fuX8JmOg9+oN/R2mhAgMBAAGjggGuMIIBqjAdBgNVHQ4EFgQUdIWAwGbH3zfez70pN6oDHb7tzRcwHwYDVR0jBBgwFoAUTiJUIBiV5uNu5g/6+rkS7QYXjzkwDgYDVR0PAQH/BAQDAgGGMB0GA1UdJQQWMBQGCCsGAQUFBwMBBggrBgEFBQcDAjASBgNVHRMBAf8ECDAGAQH/AgEAMHYGCCsGAQUFBwEBBGowaDAkBggrBgEFBQcwAYYYaHR0cDovL29jc3AuZGlnaWNlcnQuY29tMEAGCCsGAQUFBzAChjRodHRwOi8vY2FjZXJ0cy5kaWdpY2VydC5jb20vRGlnaUNlcnRHbG9iYWxSb290RzIuY3J0MHsGA1UdHwR0MHIwN6A1oDOGMWh0dHA6Ly9jcmwzLmRpZ2ljZXJ0LmNvbS9EaWdpQ2VydEdsb2JhbFJvb3RHMi5jcmwwN6A1oDOGMWh0dHA6Ly9jcmw0LmRpZ2ljZXJ0LmNvbS9EaWdpQ2VydEdsb2JhbFJvb3RHMi5jcmwwMAYDVR0gBCkwJzAHBgVngQwBATAIBgZngQwBAgEwCAYGZ4EMAQICMAgGBmeBDAECAzANBgkqhkiG9w0BAQsFAAOCAQEAdYvAPFvv/3Bca4r1Ie+sMeZDPYCv11WpHsOOGGx50/esQt+PiMWdtHXzyQj9iv5R8/KdIBoENc74tkF5r//Mll6U05odcC6iMYv7pcx/Vt8XN5e/wY1DhquMZn657YvxD4y11FWvXIme4KcqbbKjYzIYO8vetZ+DsxEBrCANkJcStymcNbXXkQ7vQG9tXDu9odn74ssudkDSOrssvxYL6r0DW06YOirtBVAHFZM8czmRlFpIDsbTSgGvZjm5vUI0HNsIA/NA/BLorjyritX7cnlkpuMOVbE7lT+tYDNniqy2p1zw7VpSG9Rh4SUS5ge1qpSy8Cj2YSZeVRz4Aet3cWYKMiaRXE/7uyCJhaYy3wW9w5eaVCJM1YWJaWtuluqDAAAAAAAAA5IwggOOMIICdqADAgECAhADOvHmpxGpoLsoZLEdCfrlMA0GCSqGSIb3DQEBCwUAMGExCzAJBgNVBAYTAlVTMRUwEwYDVQQKEwxEaWdpQ2VydCBJbmMxGTAXBgNVBAsTEHd3dy5kaWdpY2VydC5jb20xIDAeBgNVBAMTF0RpZ2lDZXJ0IEdsb2JhbCBSb290IEcyMB4XDTEzMDgwMTEyMDAwMFoXDTM4MDExNTEyMDAwMFowYTELMAkGA1UEBhMCVVMxFTATBgNVBAoTDERpZ2lDZXJ0IEluYzEZMBcGA1UECxMQd3d3LmRpZ2ljZXJ0LmNvbTEgMB4GA1UEAxMXRGlnaUNlcnQgR2xvYmFsIFJvb3QgRzIwggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQC7N8003HtrybJokK1Kdf9GuiEKCI31GVTJ+4jb867yOomRPHrmqwYaa8+sLeheCSREumKaftajqH7gVHUgBaxQt5xjGmww3NofGbHXHt791+DLlIM3ruwfQ07deyzSvS6lL+SpuK061JmktiXpm2sAYJJg/08hSRj3Z5CrYQacj/K66bTpkjJrtfNX6F0bzYwdq5UElUnzNS2W40lt3Xfj+0lLtKxVB6mPlbO0I7tMbUXw9qmylTC0/UxVjCdKVxR8gp3Nc5LTFkoGDIxQ0Y8eCb4XoeYhyv2D5RC8g6UKxGco9nMUFD1GdsOHFIkhNE2vD0UMpkmhurucxbEzgymFAgMBAAGjQjBAMA8GA1UdEwEB/wQFMAMBAf8wDgYDVR0PAQH/BAQDAgGGMB0GA1UdDgQWBBROIlQgGJXm427mD/r6uRLtBhePOTANBgkqhkiG9w0BAQsFAAOCAQEAYGcolG8OSGPrMd3qZxjViX08xYtKf+m+2ysX37Bfc3cqMhM5gWdChCPyRWc17Ii/+I+wYQw0pK4gTITG2/g14XbZ36ZCu8dECIZ/NnQkWtpsDRRZNb3ySd22H8mzDUcqPZkvu1y7tdQg4ZlfU0YV22ib8PMw1T4x4o2EnuOK2tqWPjUTpV/w+XBQcEdBEVcZTsCPrgbElRMXLxsln3XysY6ZoW8TsUFx/ogqyE8QIFXX8xRF5eBE9OqHlTKTDv5TRvosnf+LIrlL2QlFpN6kuJpY3Rt9Up+OWUOIgaSeJtVvrd0Nxjd97QOSG+V3X3buPI3EXVZbotlmbrM1N+UytgAAAAEAAAAAAAEAAAAAJXRsc2ZsYWdzMHgwMDAwMDAwMDppbWFwLm9yYW5nZS5mcjo5OTMAAA==  åÛ